| IED ID | IndEnz0002012190 |
| Enzyme Type ID | protease012190 |
| Protein Name |
TauPI-stichotoxin-Hcr2c TauPI-SHTX-Hcr2c Analgesic polypeptide HC2 APHC2 |
| Gene Name | |
| Organism | Heteractis crispa (Leathery sea anemone) (Radianthus macrodactylus) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Cnidaria Anthozoa (anthozoans) Hexacorallia Actiniaria (sea anemones) Stichodactylidae Heteractis Heteractis crispa (Leathery sea anemone) (Radianthus macrodactylus) |
| Enzyme Sequence | GSICLEPKVVGPCTAYFRRFYFDSETGKCTPFIYGGCEGNGNNFETLRACRAICRA |
| Enzyme Length | 56 |
| Uniprot Accession Number | C0HJF4 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: This protease inhibitor shows two different activities, it inhibits both the capsaicin receptor TRPV1 and serine proteases. It partially (max 50%) and reversibly inhibits mammalian TRPV1, a non-selective cation channel expressed by sensory neurons of the pain pathway (Ref.2 (By similarity)). The second activity is a weak inhibition of trypsin and chymotrypsin activity (Ki=0.9 uM and Ki=4.5 uM, respectively) (PubMed:20208578). In vivo, shows analgesic effects on mammals (PubMed:20208578). {ECO:0000250|UniProtKB:B2G331, ECO:0000269|PubMed:20208578, ECO:0000269|Ref.2}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (3); Domain (1); Site (1) |
| Keywords | Direct protein sequencing;Disulfide bond;Ion channel impairing toxin;Nematocyst;Neurotoxin;Protease inhibitor;Secreted;Serine protease inhibitor;Toxin |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:20208578}. Nematocyst {ECO:0000269|PubMed:20208578}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 6,191 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |