| IED ID | IndEnz0002012214 |
| Enzyme Type ID | protease012214 |
| Protein Name |
Uncharacterized oxidoreductase YkwC EC 1.1.-.- |
| Gene Name | ykwC BSU13960 |
| Organism | Bacillus subtilis (strain 168) |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Firmicutes Bacilli Bacillales Bacillaceae Bacillus Bacillus subtilis group Bacillus subtilis Bacillus subtilis subsp. subtilis Bacillus subtilis (strain 168) |
| Enzyme Sequence | MKKTIGFIGLGVMGKSMASHILNDGHPVLVYTRTKEKAESILQKGAIWKDTVKDLSKEADVIITMVGYPSDVEEVYFGSNGIIENAKEGAYLIDMTTSKPSLAKKIAEAAKEKALFALDAPVSGGDIGAQNGTLAIMVGGEKEAFEACMPIFSLMGENIQYQGPAGSGQHTKMCNQIAIAAGMIGVAEAMAYAQKSGLEPENVLKSITTGAAGSWSLSNLAPRMLQGNFEPGFYVKHFIKDMGIALEEAELMGEEMPGLSLAKSLYDKLAAQGEENSGTQSIYKLWVK |
| Enzyme Length | 288 |
| Uniprot Accession Number | O34948 |
| Absorption | |
| Active Site | ACT_SITE 172; /evidence=ECO:0000250 |
| Activity Regulation | |
| Binding Site | BINDING 97; /note=NAD; /evidence=ECO:0000250; BINDING 240; /note=NAD; /evidence=ECO:0000250 |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 1.1.-.- |
| Enzyme Function | |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | NP_BIND 6..20; /note=NAD; /evidence=ECO:0000250 |
| Features | Active site (1); Binding site (2); Chain (1); Nucleotide binding (1) |
| Keywords | Cell membrane;Membrane;NAD;Oxidoreductase;Reference proteome |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cell membrane {ECO:0000269|PubMed:22882210}. Membrane raft {ECO:0000269|PubMed:22882210}. Note=Present in detergent-resistant membrane (DRM) fractions that may be equivalent to eukaryotic membrane rafts; these rafts include proteins involved in signaling, molecule trafficking and protein secretion. {ECO:0000269|PubMed:22882210}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 22512862; |
| Motif | |
| Gene Encoded By | |
| Mass | 30,711 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |