| IED ID | IndEnz0002012226 |
| Enzyme Type ID | protease012226 |
| Protein Name |
Regulator of G-protein signaling 17 RGS17 Regulator of Gz-selective protein signaling 2 |
| Gene Name | Rgs17 Rgsz2 |
| Organism | Mus musculus (Mouse) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Glires (Rodents and rabbits) Rodentia Myomorpha (mice and others) Muroidea Muridae Murinae Mus Mus Mus musculus (Mouse) |
| Enzyme Sequence | MRKRQQSQNEGTQAVSQAPGNQRPNNTCCFCWCCCCSCSCLTVRNEERGDSSGRSPHTTKMESIQVLEECQNPTADEVLSWSQNFDKMMKTPAGRNLFREFLRTEYSEENLLFWLACEDLKKEQNKKAVEEKARMIYEDYISILSPKEVSLDSRVREVINRSLLDPSPHMYEDAQLQIYTLMHRDSFPRFLNSQIYKAFVESTTSCTSES |
| Enzyme Length | 210 |
| Uniprot Accession Number | Q9QZB0 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Regulates G protein-coupled receptor signaling cascades, including signaling via muscarinic acetylcholine receptor CHRM2 and dopamine receptor DRD2 (By similarity). Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits, thereby driving them into their inactive GDP-bound form. Binds selectively to GNAZ and GNAI2 subunits, accelerates their GTPase activity and regulates their signaling activities. Negatively regulates mu-opioid receptor-mediated activation of the G-proteins. {ECO:0000250|UniProtKB:Q9UGC6, ECO:0000269|PubMed:15827571, ECO:0000269|PubMed:16900103}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Compositional bias (1); Domain (1); Modified residue (1); Region (1) |
| Keywords | Cell junction;Cytoplasm;GTPase activation;Glycoprotein;Membrane;Nucleus;Phosphoprotein;Reference proteome;Signal transduction inhibitor;Synapse;Synaptosome;Ubl conjugation |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Membrane {ECO:0000269|PubMed:15827571, ECO:0000269|PubMed:16900103}. Cell junction, synapse, synaptosome {ECO:0000269|PubMed:15827571, ECO:0000269|PubMed:16900103}. Nucleus {ECO:0000269|PubMed:16900103}. Cytoplasm {ECO:0000269|PubMed:16900103}. |
| Modified Residue | MOD_RES 137; /note=Phosphotyrosine; /evidence=ECO:0007744|PubMed:18034455 |
| Post Translational Modification | PTM: N- and O-glycosylated in synapsomal membranes. {ECO:0000269|PubMed:15827571}.; PTM: Serine phosphorylated in synapsomal membranes. {ECO:0000269|PubMed:16900103}.; PTM: Sumoylated with SUMO1 and SUM02 in synaptosomes. The sumoylated forms act as a scaffold for sequestering mu-opioid receptor-activated G(alpha) subunits (PubMed:16900103). Desumoylated by HINT1 (PubMed:31088288). {ECO:0000269|PubMed:16900103, ECO:0000269|PubMed:31088288}. |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 11217851; 11342430; 11829488; 12466851; 15096504; 16602821; 18652891; 21267068; 21348811; 21677750; 22163035; 22967998; 30478225; |
| Motif | |
| Gene Encoded By | |
| Mass | 24,345 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |