| IED ID |
IndEnz0002012230 |
| Enzyme Type ID |
protease012230 |
| Protein Name |
Cell division inhibitor SulA
|
| Gene Name |
sulA SG0961 |
| Organism |
Salmonella gallinarum (strain 287/91 / NCTC 13346) |
| Taxonomic Lineage |
cellular organisms
Bacteria
Proteobacteria
Gammaproteobacteria
Enterobacterales
Enterobacteriaceae
Salmonella
Salmonella enterica (Salmonella choleraesuis)
Salmonella enterica I
Salmonella gallinarum
Salmonella gallinarum (strain 287/91 / NCTC 13346)
|
| Enzyme Sequence |
MYTSGYANRSSSFPTTTHNAALTATENAAAGLVSEVVYHEDQPMMAQLLLLPLLRQLGQQSRWQLWLTPQQKLSREWVQSSGLPLTKVMQISQLAPRHTLESMIRALRTGNYSVVIGWMTEELTEEEHASLVEAAKVGNAVGFIMRPVRAHALSRRQHSGLKIHSNLYH |
| Enzyme Length |
169 |
| Uniprot Accession Number |
B5R6C4 |
| Absorption |
|
| Active Site |
|
| Activity Regulation |
|
| Binding Site |
|
| Calcium Binding |
|
| catalytic Activity |
|
| DNA Binding |
|
| EC Number |
|
| Enzyme Function |
FUNCTION: Component of the SOS system and an inhibitor of cell division. Accumulation of SulA causes rapid cessation of cell division and the appearance of long, non-septate filaments. In the presence of GTP, binds a polymerization-competent form of FtsZ in a 1:1 ratio, thus inhibiting FtsZ polymerization and therefore preventing it from participating in the assembly of the Z ring. This mechanism prevents the premature segregation of damaged DNA to daughter cells during cell division. {ECO:0000255|HAMAP-Rule:MF_01179}. |
| Temperature Dependency |
|
| PH Dependency |
|
| Pathway |
|
| nucleotide Binding |
|
| Features |
Chain (1); Region (2); Site (1) |
| Keywords |
Cell cycle;Cell division;DNA damage;SOS response;Septation |
| Interact With |
|
| Induction |
INDUCTION: By DNA damage, as part of the SOS response. {ECO:0000255|HAMAP-Rule:MF_01179}. |
| Subcellular Location |
|
| Modified Residue |
|
| Post Translational Modification |
PTM: Is rapidly cleaved and degraded by the Lon protease once DNA damage is repaired. {ECO:0000255|HAMAP-Rule:MF_01179}. |
| Signal Peptide |
|
| Structure 3D |
|
| Cross Reference PDB |
- |
| Mapped Pubmed ID |
- |
| Motif |
|
| Gene Encoded By |
|
| Mass |
18,960 |
| Kinetics |
|
| Metal Binding |
|
| Rhea ID |
|
| Cross Reference Brenda |
|