| IED ID | IndEnz0002012240 |
| Enzyme Type ID | protease012240 |
| Protein Name |
Putative metalloproteinase inhibitor tag-225 TIMP-like protein |
| Gene Name | tag-225 K07C11.5 |
| Organism | Caenorhabditis elegans |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Ecdysozoa Nematoda (roundworms) Chromadorea Rhabditida Rhabditina Rhabditomorpha Rhabditoidea Rhabditidae Peloderinae Caenorhabditis Caenorhabditis elegans |
| Enzyme Sequence | MQNLSLSLVILSVLIAVTLACKCREQSTKESFCNAHWVSHVKVKVRVGKQGLPEGSERKGLNNLRYTVQHVEVFKKPSNMTTLPDEIFTPSEAPACGLKIAAGHEYLLAGRVEGPNALYTVLCGQVLPDDRSQTSFENVLEWKNVPQTLQSQVKSIKC |
| Enzyme Length | 158 |
| Uniprot Accession Number | Q21265 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Complexes with metalloproteinases and irreversibly inactivates them by binding to their catalytic zinc cofactor. {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (3); Domain (1); Glycosylation (1); Metal binding (1); Region (2); Signal peptide (1) |
| Keywords | Disulfide bond;Glycoprotein;Metal-binding;Metalloenzyme inhibitor;Metalloprotease inhibitor;Protease inhibitor;Reference proteome;Secreted;Signal;Zinc |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000250|UniProtKB:P16035, ECO:0000305}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..20; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 10778742; 15338614; 17486083; 17848203; 17850180; 18463287; 21177967; 22267497; 22560298; 23800452; 24884423; 25487147; 30992386; 6593563; |
| Motif | |
| Gene Encoded By | |
| Mass | 17,465 |
| Kinetics | |
| Metal Binding | METAL 21; /note=Zinc; via amino nitrogen and carbonyl oxygen; shared with metalloproteinase partner; /evidence=ECO:0000250 |
| Rhea ID | |
| Cross Reference Brenda |