| IED ID | IndEnz0002012258 |
| Enzyme Type ID | protease012258 |
| Protein Name |
Testisin EC 3.4.21.- Serine protease 21 Tryptase 4 |
| Gene Name | Prss21 |
| Organism | Mus musculus (Mouse) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Glires (Rodents and rabbits) Rodentia Myomorpha (mice and others) Muroidea Muridae Murinae Mus Mus Mus musculus (Mouse) |
| Enzyme Sequence | MGARGKTLVPLLVVVATAAMALQSTYLQVDPEKPELQEPDLLSGPCGHRTIPSRIVGGDDAELGRWPWQGSLRVWGNHLCGATLLNRRWVLTAAHCFQKDNDPFDWTVQFGELTSRPSLWNLQAYSNRYQIEDIFLSPKYSEQYPNDIALLKLSSPVTYNNFIQPICLLNSTYKFENRTDCWVTGWGAIGEDESLPSPNTLQEVQVAIINNSMCNHMYKKPDFRTNIWGDMVCAGTPEGGKDACFGDSGGPLACDQDTVWYQVGVVSWGIGCGRPNRPGVYTNISHHYNWIQSTMIRNGLLRPDPVPLLLFLTLAWASSLLRPA |
| Enzyme Length | 324 |
| Uniprot Accession Number | Q9JHJ7 |
| Absorption | |
| Active Site | ACT_SITE 95; /note=Charge relay system; /evidence=ECO:0000255; ACT_SITE 147; /note=Charge relay system; /evidence=ECO:0000255; ACT_SITE 248; /note=Charge relay system; /evidence=ECO:0000255 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.21.- |
| Enzyme Function | FUNCTION: Could regulate proteolytic events associated with testicular germ cell maturation. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (3); Chain (1); Disulfide bond (5); Domain (1); Erroneous termination (1); Glycosylation (4); Lipidation (1); Propeptide (2); Sequence conflict (1); Signal peptide (1) |
| Keywords | Cell membrane;Disulfide bond;GPI-anchor;Glycoprotein;Hydrolase;Lipoprotein;Membrane;Protease;Reference proteome;Serine protease;Signal;Zymogen |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cell membrane {ECO:0000305}; Lipid-anchor, GPI-anchor {ECO:0000305}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..21; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 11217851; 11861648; 12466851; 14583634; 18754795; 19571264; 20484738; 21677750; 22362218; 23943622; 30911775; 32511276; |
| Motif | |
| Gene Encoded By | |
| Mass | 36,175 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |