| IED ID | IndEnz0002012268 |
| Enzyme Type ID | protease012268 |
| Protein Name |
Thrombin-like enzyme BjussuSP-1 SVTLE BjussuSP-1 EC 3.4.21.- Fibrinogen-clotting enzyme Jararacussin-I Snake venom serine protease 1 SVSP Thrombin-like enzyme BjussuSP-I SVTLE BjussuSP-I |
| Gene Name | |
| Organism | Bothrops jararacussu (Jararacussu) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Sauropsida Sauria (diapsids) Lepidosauria (lepidosaurs) Squamata (squamates) Bifurcata (split-tongued squamates) Unidentata Episquamata Toxicofera Serpentes (snakes) Colubroidea Viperidae Crotalinae (pit vipers) Bothrops Bothrops jararacussu (Jararacussu) |
| Enzyme Sequence | VLGGDECDINEHPFLAFLYSHGYFCGLTLINQEWVVTAAHCDSTNFQMQLGVHSKKVLNEDEQTRNPKEKFICPNKNMSEVLDKDIMLIKLDKPISNSKHIAPLSLPSNPPSVGSVCRIMGWGSITIPNETYPDVPYCANINLVDYEVCQGAYNGLPAKTTLCAGVLEGGKDTCVGDSGGPLICNGQFQGIVSYGAHSCGQGPKPGIYTNVFDYTDWIQRNIAGNTDATCPP |
| Enzyme Length | 232 |
| Uniprot Accession Number | Q2PQJ3 |
| Absorption | |
| Active Site | ACT_SITE 40; /note=Charge relay system; /evidence=ECO:0000250; ACT_SITE 85; /note=Charge relay system; /evidence=ECO:0000250; ACT_SITE 178; /note=Charge relay system; /evidence=ECO:0000250 |
| Activity Regulation | ACTIVITY REGULATION: Inhibited by leupeptin, heparin, and 1.10-phenantroline. {ECO:0000269|PubMed:17466550, ECO:0000269|PubMed:17996740}. |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.21.- |
| Enzyme Function | FUNCTION: Thrombin-like enzyme that shows clotting activity upon human plasma. Shows specific fibrinogenolytic activity for Aalpha chain (FGA). Hydrolyzes fibrin, BAPNA and TAME, as well as chromogenic artificial substrates of the blood coagulation cascasde: S-27654 for factor X (F10), S-2302 for kallikrein (KLK), factor XIa (F11), and XIIa (F12), and S-2266 for kallikrein and factor XIa (F11). Subcutaneous injection into mice induces a mild edema. Intravenous and intramuscular injection reduce plasma fibrinogen concentration and increase the levels of fibrin(ogen) degradation products. Intramuscular injection also promotes an increase in the expression of proMMP-9, but is unable to activate it. {ECO:0000269|PubMed:17292935, ECO:0000269|PubMed:17466550, ECO:0000269|PubMed:17996740}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (3); Beta strand (13); Chain (1); Disulfide bond (6); Domain (1); Glycosylation (2); Helix (4); Turn (1) |
| Keywords | 3D-structure;Blood coagulation cascade activating toxin;Direct protein sequencing;Disulfide bond;Fibrinolytic toxin;Glycoprotein;Hemostasis impairing toxin;Hydrolase;Protease;Secreted;Serine protease;Sialic acid;Toxin |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
| Modified Residue | |
| Post Translational Modification | PTM: N-glycosylated. Contains sialic acid residues. Deglycosylation reduces in 50% the formation of fibrin clot. {ECO:0000269|PubMed:17466550, ECO:0000269|PubMed:17996740}. |
| Signal Peptide | |
| Structure 3D | X-ray crystallography (1) |
| Cross Reference PDB | 4GSO; |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 25,163 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |