| IED ID | IndEnz0002012276 |
| Enzyme Type ID | protease012276 |
| Protein Name |
Kunitz-type serine protease inhibitor homolog calcicludine CAC L-type calcium channel blocker |
| Gene Name | |
| Organism | Dendroaspis angusticeps (Eastern green mamba) (Naja angusticeps) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Sauropsida Sauria (diapsids) Lepidosauria (lepidosaurs) Squamata (squamates) Bifurcata (split-tongued squamates) Unidentata Episquamata Toxicofera Serpentes (snakes) Colubroidea Elapidae Elapinae Dendroaspis Dendroaspis angusticeps (Eastern green mamba) (Naja angusticeps) |
| Enzyme Sequence | WQPPWYCKEPVRIGSCKKQFSSFYFKWTAKKCLPFLFSGCGGNANRFQTIGECRKKCLGK |
| Enzyme Length | 60 |
| Uniprot Accession Number | P81658 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Potent blocker of high-voltage-activated calcium ion channels in the nanomolar range, particularly the L-type channels in cerebellar granule cells. The sensitivity of L-, N- and P-type channels to CAC is tissue and species-dependent. Blocks the L-type current of cardiac cells, depressing cardiac contractility. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (5); Chain (1); Disulfide bond (3); Domain (1); Helix (2); Turn (1) |
| Keywords | 3D-structure;Calcium channel impairing toxin;Cardiotoxin;Direct protein sequencing;Disulfide bond;Ion channel impairing toxin;Neurotoxin;Secreted;Toxin |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | NMR spectroscopy (1); X-ray crystallography (2) |
| Cross Reference PDB | 1BF0; 5YV7; 6KZF; |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 6,986 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |