| IED ID | IndEnz0002012289 |
| Enzyme Type ID | protease012289 |
| Protein Name |
Snake venom metalloproteinase BnP2 SVMP EC 3.4.24.- Fragments |
| Gene Name | |
| Organism | Bothrops pauloensis (Neuwied's lancehead) (Bothrops neuwiedi pauloensis) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Sauropsida Sauria (diapsids) Lepidosauria (lepidosaurs) Squamata (squamates) Bifurcata (split-tongued squamates) Unidentata Episquamata Toxicofera Serpentes (snakes) Colubroidea Viperidae Crotalinae (pit vipers) Bothrops Bothrops neuwiedi group Bothrops pauloensis (Neuwied's lancehead) (Bothrops neuwiedi pauloensis) |
| Enzyme Sequence | YIELAVVADHGMFTKYNSNIDTIRVHEMVNTVDGFFRSMNVDASIANIEVWSKTITSFGEWRERDIIPR |
| Enzyme Length | 69 |
| Uniprot Accession Number | P0C6S1 |
| Absorption | |
| Active Site | |
| Activity Regulation | ACTIVITY REGULATION: Inhibited by EDTA. {ECO:0000250}. |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.24.- |
| Enzyme Function | FUNCTION: This protein is a zinc protease from snake venom that is devoid of significant myotoxic and hemorrhagic activities. It hydrolyzes the Aalpha-chain and more slowly the Bbeta-chain of fibrin and fibrinogen, without affecting the gamma-chains. It induces cell detachment and a apoptosis (anoikis) in endothelial cells (By similarity). {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Domain (1); Metal binding (1); Non-adjacent residues (2); Non-terminal residue (2); Sequence uncertainty (7) |
| Keywords | Apoptosis;Direct protein sequencing;Fibrinogenolytic toxin;Fibrinolytic toxin;Hemostasis impairing toxin;Hydrolase;Metal-binding;Metalloprotease;Protease;Secreted;Toxin;Zinc |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 8,008 |
| Kinetics | |
| Metal Binding | METAL 3; /note=Calcium 1; /evidence=ECO:0000250 |
| Rhea ID | |
| Cross Reference Brenda |