| IED ID | IndEnz0002012301 |
| Enzyme Type ID | protease012301 |
| Protein Name |
Natriuretic peptide PtNP-a Fragment |
| Gene Name | |
| Organism | Pseudonaja textilis (Eastern brown snake) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Sauropsida Sauria (diapsids) Lepidosauria (lepidosaurs) Squamata (squamates) Bifurcata (split-tongued squamates) Unidentata Episquamata Toxicofera Serpentes (snakes) Colubroidea Elapidae Acanthophiinae Pseudonaja Pseudonaja textilis (Eastern brown snake) |
| Enzyme Sequence | SGSKIGNGCFGLPLDRISNTSGMGCRNPIQNRPKSTPGGS |
| Enzyme Length | 40 |
| Uniprot Accession Number | Q3SAF6 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Snake venom natriuretic peptide that exhibits hypotensive and vasodepressor activity (By similarity). Recombinant PtNP-a demonstrates a dose-dependent stimulation of cGMP production via the natriuretic peptide receptor-A (NPR1). It also inhibits the angiotensin converting enzyme (ACE). {ECO:0000250, ECO:0000269|PubMed:16908092}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Compositional bias (1); Disulfide bond (1); Non-terminal residue (1); Peptide (1); Propeptide (1); Region (1) |
| Keywords | Disulfide bond;Hypotensive agent;Metalloenzyme inhibitor;Metalloprotease inhibitor;Protease inhibitor;Reference proteome;Secreted;Toxin;Vasoactive;Vasodilator |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000250}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 4,063 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |