| IED ID | IndEnz0002012303 |
| Enzyme Type ID | protease012303 |
| Protein Name |
Cysteine protease S273R pS273R EC 3.4.22.- |
| Gene Name | Ba71V-111 S273R |
| Organism | African swine fever virus (strain Badajoz 1971 Vero-adapted) (Ba71V) (ASFV) |
| Taxonomic Lineage | Viruses Varidnaviria Bamfordvirae Nucleocytoviricota Pokkesviricetes Asfuvirales Asfarviridae Asfivirus African swine fever virus (ASFV) African swine fever virus (strain Badajoz 1971 Vero-adapted) (Ba71V) (ASFV) |
| Enzyme Sequence | MSILEKITSSPSECAEHLTNKDSCLSKKIQKELTSFLEKKETLGCDSESCVITHPAVKAYAQQKGLDLSKELETRFKAPGPRNNTGLLTNFNIDETLQRWAIKYTKFFNCPFSMMDFERVHYKFNQVDMVKVYKGEELQYVEGKVVKRPCNTFGCVLNTDFSTGTGKHWVAIFVDMRGDCWSIEYFNSAGNSPPGPVIRWMERVKQQLLKIHHTVKTLAVTNIRHQRSQTECGPYSLFYIRARLDNVSYAHFISARITDEDMYKFRTHLFRIA |
| Enzyme Length | 273 |
| Uniprot Accession Number | Q00946 |
| Absorption | |
| Active Site | ACT_SITE 168; /evidence=ECO:0000305|PubMed:11031264; ACT_SITE 187; /evidence=ECO:0000250|UniProtKB:P0C9B9; ACT_SITE 232; /note=Nucleophile; /evidence=ECO:0000305|PubMed:11031264 |
| Activity Regulation | |
| Binding Site | BINDING 226; /note=Substrate; /evidence=ECO:0000255 |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.22.- |
| Enzyme Function | FUNCTION: SUMO-1 cysteine protease catalyzes the maturation of the pp220 and pp62 polyprotein precursors into core-shell proteins. {ECO:0000269|PubMed:11031264, ECO:0000269|PubMed:12719549}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (3); Binding site (1); Chain (1); Mutagenesis (2) |
| Keywords | Host cytoplasm;Hydrolase;Late protein;Protease;Reference proteome;Thiol protease;Virion |
| Interact With | |
| Induction | INDUCTION: Expressed in the late phase of the viral replicative cycle. {ECO:0000269|PubMed:32075923}. |
| Subcellular Location | SUBCELLULAR LOCATION: Host cytoplasm {ECO:0000269|PubMed:11031264}. Virion {ECO:0000269|PubMed:11031264, ECO:0000269|PubMed:30185597}. Note=Found in the perinuclear cytoplasmic viral factories during assembly. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 31,550 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |