| IED ID | IndEnz0002012325 |
| Enzyme Type ID | protease012325 |
| Protein Name |
Thrombin-like enzyme leucurobin Leuc SVTLE EC 3.4.21.74 Fibrinogen-clotting enzyme Snake venom serine protease SVSP |
| Gene Name | |
| Organism | Bothrops leucurus (Whitetail lancehead) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Sauropsida Sauria (diapsids) Lepidosauria (lepidosaurs) Squamata (squamates) Bifurcata (split-tongued squamates) Unidentata Episquamata Toxicofera Serpentes (snakes) Colubroidea Viperidae Crotalinae (pit vipers) Bothrops Bothrops leucurus (Whitetail lancehead) |
| Enzyme Sequence | VIGGDECDINEHPFLAFMYYSPRYFCGMTLINQEWVLTAAHCNRRFMRIXXXXHAGSVANYDEVVRXXXXXFICPNKKKNVITDKDIMLIRLDRPVKNSEHIAPLSLPSNPPSVGSVCRIMGWGAITTSEDTYPDVPHCANINLFNNTVCREAYNGLPAKTLCAGVLQGGIDTCGGDSGGPLICNGQFQGILSWGSDPCAEPRKPAFYTKVFDYLPWIQSIIAGNKTATCP |
| Enzyme Length | 231 |
| Uniprot Accession Number | P0DJ86 |
| Absorption | |
| Active Site | ACT_SITE 41; /note=Charge relay system; /evidence=ECO:0000250; ACT_SITE 86; /note=Charge relay system; /evidence=ECO:0000250; ACT_SITE 178; /note=Charge relay system; /evidence=ECO:0000250 |
| Activity Regulation | ACTIVITY REGULATION: Inhibited by PMSF and benzamidine. Its clotting effect is strongly inhibited by antibothropic serum. Is not inhibited by heparin. {ECO:0000269|PubMed:16481207}. |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Selective cleavage of Arg-|-Xaa bond in fibrinogen, to form fibrin, and release fibrinopeptide A. The specificity of further degradation of fibrinogen varies with species origin of the enzyme.; EC=3.4.21.74; Evidence={ECO:0000269|PubMed:16481207}; |
| DNA Binding | |
| EC Number | 3.4.21.74 |
| Enzyme Function | FUNCTION: Thrombin-like snake venom serine protease that cleaves Arg-Gly bonds in alpha-chain of fibrinogen (FGA). Induces temporary episodes of opisthotonos and rapid rolling around the long axis of the animal (gyroxin-like effect), when injected into the tail veins of mice (0.143 ug/g mouse). {ECO:0000269|PubMed:16481207}. |
| Temperature Dependency | |
| PH Dependency | BIOPHYSICOCHEMICAL PROPERTIES: pH dependence: Optimum pH is 7.0-8.5. {ECO:0000269|PubMed:16481207}; |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (3); Chain (1); Disulfide bond (6); Domain (1); Glycosylation (2); Site (1) |
| Keywords | Blood coagulation cascade activating toxin;Direct protein sequencing;Disulfide bond;Glycoprotein;Hemostasis impairing toxin;Hydrolase;Protease;Secreted;Serine protease;Toxin |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:16481207}. |
| Modified Residue | |
| Post Translational Modification | PTM: Glycosylated. |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 25,425 |
| Kinetics | BIOPHYSICOCHEMICAL PROPERTIES: Kinetic parameters: KM=9.9 uM for H-D-Val-Leu-Arg-pNA (S-2266) {ECO:0000269|PubMed:16481207}; KM=7.9 uM for H-D-Pro-Phe-Arg-pNA (S-2302) {ECO:0000269|PubMed:16481207}; KM=2.7 uM for Bz-Phe-Val-Arg-pNA (S-2160) {ECO:0000269|PubMed:16481207}; KM=5.7 uM for H-D-Val-Leu-Lys-pNA (S-2251) {ECO:0000269|PubMed:16481207}; |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |