| IED ID | IndEnz0002012344 |
| Enzyme Type ID | protease012344 |
| Protein Name |
Ancillary SecYEG translocon subunit Periplasmic chaperone YfgM |
| Gene Name | yfgM b2513 JW2497 |
| Organism | Escherichia coli (strain K12) |
| Taxonomic Lineage | cellular organisms Bacteria Proteobacteria Gammaproteobacteria Enterobacterales Enterobacteriaceae Escherichia Escherichia coli Escherichia coli (strain K12) |
| Enzyme Sequence | MEIYENENDQVEAVKRFFAENGKALAVGVILGVGALIGWRYWNSHQVDSARSASLAYQNAVTAVSEGKPDSIPAAEKFAAENKNTYGALASLELAQQFVDKNELEKAAAQLQQGLADTSDENLKAVINLRLARVQVQLKQADAALKTLDTIKGEGWAAIVADLRGEALLSKGDKQGARSAWEAGVKSDVTPALSEMMQMKINNLSI |
| Enzyme Length | 206 |
| Uniprot Accession Number | P76576 |
| Absorption | |
| Active Site | |
| Activity Regulation | ACTIVITY REGULATION: Is stable during exponential growth and degraded in stationary phase by the essential FtsH protease. Degradation is influenced by the alarmone (p)ppGpp, but not by inorganic polyphosphate (polyP), RpoS, RcsB or PpiD. {ECO:0000269|PubMed:26092727}. |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: May mediate protein transfer from the SecYEG translocon to the periplasmic chaperone network via its periplasmic C-terminal region (PubMed:24855643). In addition, at the cytosolic site, acts as a negative regulator of RcsB (PubMed:26092727). In stationary phase, the FtsH-dependent degradation of YfgM ensures the release of RcsB from YfgM and thereby permits cellular protection by the Rcs phosphorelay system (PubMed:26092727). May coordinate stress responses across the inner membrane via a dynamic protein-protein interaction network inside and outside of the membrane (PubMed:26092727). {ECO:0000269|PubMed:24855643, ECO:0000269|PubMed:26092727}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Mutagenesis (19); Topological domain (2); Transmembrane (1) |
| Keywords | Cell inner membrane;Cell membrane;Chaperone;Membrane;Reference proteome;Transmembrane;Transmembrane helix |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cell inner membrane {ECO:0000269|PubMed:21210718}; Single-pass type II membrane protein {ECO:0000269|PubMed:21210718}; Periplasmic side {ECO:0000269|PubMed:21210718}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 16606699; 16858726; 22885295; 24561554; |
| Motif | |
| Gene Encoded By | |
| Mass | 22,176 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |