| IED ID | IndEnz0002012408 |
| Enzyme Type ID | protease012408 |
| Protein Name |
Cysteine protease-like VirA EC 3.4.22.- Effector protein VirA |
| Gene Name | virA SDY_P211 |
| Organism | Shigella dysenteriae serotype 1 (strain Sd197) |
| Taxonomic Lineage | cellular organisms Bacteria Proteobacteria Gammaproteobacteria Enterobacterales Enterobacteriaceae Shigella Shigella dysenteriae Shigella dysenteriae serotype 1 (strain Sd197) |
| Enzyme Sequence | MQTSNITNYERNDSSWMSTVKSTTEVSWNKLSFCDVLLKIITFGIYSPHETLAEKYSEKKLMDSFSPSLSQDKMDGEFAHANIDGISIRLCLNKGICSVFYLDGDKIQSTQLSSKEYNNLLSSLPPKQFNLGKVHTITAPVSGNFKTHKPAPEVIETAINCCTSIIPNDDYFSVKDTDFNSVWHDIYRDIRASDSNSTKIYFNNIEIPLKLIADLINELGINEFIDSKKELQMLSYNQVNKIINSNFPQQDLCFQTEKLLFTSLFQDPAFISALTSAFWQSLHITSSSVEHIYAQIMSENIENRLNFMPEQRVINNCGHIIKINAVVPKNDTAISASGGRAYEVSSSILPSHITCNGVGINKIETSYLVHAGTLPSSEGLRNAIPPESRQVSFAIISPDV |
| Enzyme Length | 400 |
| Uniprot Accession Number | Q326N4 |
| Absorption | |
| Active Site | ACT_SITE 34; /evidence=ECO:0000255 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.22.- |
| Enzyme Function | FUNCTION: Alpha-tubulin-specific protease that is required for entry into epithelial cells and for subsequent intra- and intercellular spreading. Contributes to bacterial entry into epithelial cells by inducing microtubule (MT) destabilization and the formation of membrane ruffles. The membrane ruffling evoked by VirA results from the activation of host rac1, which is associated with the destruction of MT networks. Creates a tunnel inside the host cell cytoplasm by breaking down the microtubule infrastructure. This facilitates the bacterium's movement through the cytoplasm and also helps other bacteria move faster during the invasion of the eukaryotic cell. Is absolutely required for virulence (By similarity). {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (1); Chain (1); Region (1) |
| Keywords | Hydrolase;Plasmid;Protease;Reference proteome;Secreted;Thiol protease;Virulence |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. Note=Translocated into the host cell via the type III secretion system (TTSS). Localizes in the cytoplasm of the infected cell (By similarity). {ECO:0000250}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | Plasmid pSD1_197 |
| Mass | 44,723 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |