| IED ID | IndEnz0002012415 |
| Enzyme Type ID | protease012415 |
| Protein Name |
Core protein VP8 25 kDa major core protein F5 polypeptide L4 core protein P25K |
| Gene Name | VACWR091 L4R |
| Organism | Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR)) |
| Taxonomic Lineage | Viruses Varidnaviria Bamfordvirae Nucleocytoviricota Pokkesviricetes Chitovirales Poxviridae Chordopoxvirinae Orthopoxvirus Vaccinia virus Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR)) |
| Enzyme Sequence | MSLLLENLIEEDTIFFAGSISEYDDLQMVIAGAKSKFPRSMLSIFNIVPRTMSKYELELIHNENITGAMFTTMYNIRNNLGLGDDKLTIEAIENYFLDPNNEVMPLIINNTDMTAVIPKKSGRRKNKNMVIFRQGSSPILCIFETRKKINIYKENMESASTEYTPIGDNKALISKYAGINILNVYSPSTSIRLNAIYGFTNKNKLEKLSTNKELESYSSSPLQEPIRLNDFLGLLECVKKNIPLTDIPTKD |
| Enzyme Length | 251 |
| Uniprot Accession Number | P03295 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Major core structural protein. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Mutagenesis (2); Propeptide (1); Sequence conflict (1); Site (2) |
| Keywords | Direct protein sequencing;Late protein;Reference proteome;Virion |
| Interact With | |
| Induction | INDUCTION: Expressed in the late phase of the viral replicative cycle. {ECO:0000269|PubMed:3201753}. |
| Subcellular Location | SUBCELLULAR LOCATION: Virion {ECO:0000269|PubMed:3201752}. Note=Localizes to the virion core. |
| Modified Residue | |
| Post Translational Modification | PTM: Undergoes morphogenesis-associated proteolysis which cleaves the 28 kDa to a 25-kDa product. Proteolytic cleavage of major core proteins P4a (A10L), P4b (A3L), and VP8 (L4R), which occurs at a late stage of core formation, is required for production of infectious mature virions (MV). {ECO:0000269|PubMed:15163727, ECO:0000269|PubMed:3201753}. |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 10781095; |
| Motif | |
| Gene Encoded By | |
| Mass | 28,457 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |