| IED ID | IndEnz0002012423 |
| Enzyme Type ID | protease012423 |
| Protein Name |
Early 35 kDa protein Apoptosis-preventing protein p35 |
| Gene Name | P35 |
| Organism | Bombyx mori nuclear polyhedrosis virus (BmNPV) |
| Taxonomic Lineage | Viruses Naldaviricetes Lefavirales Baculoviridae Alphabaculovirus Bombyx mori nuclear polyhedrosis virus (BmNPV) |
| Enzyme Sequence | MCVIFPVEIDVSQTVIRDCHVDEQTRELVYINKIMNTQLTKPVLMMFNISGPIRSVTRKNNDLRDRIKSKVDEQFDQLEREYSDKIDGFHDNIQYFKDEHYSVSCQNGSVLKSKFAKILKSHDYTDKKSIETYEKYCLPQLVDKHNDCYVAVCVLKPGFENGSNQVLSFEYNPIGNKVIVPFAHEINDTGLYEYDVLAYVDSVEFDGKQFEEFVQKLILPSSFNDSEKVLYYNEASKNKNMIYKALEFTTESSWVKSNKFNWKIFCNGFIYDKKSKALYVKLHNVTSTLNKNVILDMIK |
| Enzyme Length | 299 |
| Uniprot Accession Number | P31354 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Blocks the insect or worm host cells apoptotic response initiated by the viral infection. Confers protection from cell death in mammalian cells. Acts by blocking the activity of members of the caspase family of proteases. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1) |
| Keywords | Apoptosis;Early protein;Host-virus interaction;Inhibition of host caspases by virus;Modulation of host cell apoptosis by virus;Protease inhibitor;Thiol protease inhibitor |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 34,912 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |