| IED ID | IndEnz0002012462 |
| Enzyme Type ID | protease012462 |
| Protein Name |
Sporulation-specific protease YabG EC 3.4.-.- |
| Gene Name | yabG BSU00430 |
| Organism | Bacillus subtilis (strain 168) |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Firmicutes Bacilli Bacillales Bacillaceae Bacillus Bacillus subtilis group Bacillus subtilis Bacillus subtilis subsp. subtilis Bacillus subtilis (strain 168) |
| Enzyme Sequence | MQFQIGDMVARKSYQMDVLFRIIGIEQTSKGNSIAILHGDEVRLIADSDFSDLVAVKKDEQMMRKKKDESRMNESLELLRQDYKLLREKQEYYATSQYQHQEHYFHMPGKVLHLDGDEAYLKKCLNVYKKIGVPVYGIHCHEKKMSASIEVLLDKYRPDILVITGHDAYSKQKGGIDDLNAYRHSKHFVETVQTARKKIPHLDQLVIFAGACQSHFESLIRAGANFASSPSRVNIHALDPVYIVAKISFTPFMERINVWEVLRNTLTREKGLGGIETRGVLRIGMPYKSN |
| Enzyme Length | 290 |
| Uniprot Accession Number | P37548 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.-.- |
| Enzyme Function | FUNCTION: Cleaves the spore coat proteins SpoIVA and SafA. May cooperate with tgl to mediate the temperature-dependent cross-linking of coat proteins like GerQ. {ECO:0000269|PubMed:11040425}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1) |
| Keywords | Hydrolase;Membrane;Reference proteome;Sporulation |
| Interact With | |
| Induction | INDUCTION: Induced by SigK. |
| Subcellular Location | SUBCELLULAR LOCATION: Forespore outer membrane {ECO:0000269|PubMed:10714992}. Note=Synthesized in the mother cell compartment and assembled on the surface of the forespore. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 33,318 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |