| IED ID |
IndEnz0002012468 |
| Enzyme Type ID |
protease012468 |
| Protein Name |
Putative peptide zinc metalloprotease protein YydH
|
| Gene Name |
yydH BSU40160 |
| Organism |
Bacillus subtilis (strain 168) |
| Taxonomic Lineage |
cellular organisms
Bacteria
Terrabacteria group
Firmicutes
Bacilli
Bacillales
Bacillaceae
Bacillus
Bacillus subtilis group
Bacillus subtilis
Bacillus subtilis subsp. subtilis
Bacillus subtilis (strain 168)
|
| Enzyme Sequence |
MKILKYEDEKYEVLVQNNVFIKDKKSGEYYKNSLNSLSDKQLLRFKMYKEKVSPKFFYLFLSFTALMFILNYIHLIKLQNGLSSVFYGWKMWIIIVIYFIMNIVLHELGHIYSLKFFGKNFDKVGFKLNFYVFPAFYVQLNETYMLSRNEKIIVHLFGLFINYLLINTLELINQFTFSSEALTMAFMLFSSTLLWNLIPILNSDGYKILLAFLSLDEYSRFKTNHWLVLTIQIIGIGLAVNSVVHWILYIVN |
| Enzyme Length |
252 |
| Uniprot Accession Number |
Q45594 |
| Absorption |
|
| Active Site |
ACT_SITE 107; /evidence=ECO:0000255|PROSITE-ProRule:PRU10095 |
| Activity Regulation |
|
| Binding Site |
|
| Calcium Binding |
|
| catalytic Activity |
|
| DNA Binding |
|
| EC Number |
|
| Enzyme Function |
FUNCTION: Required for production of the modified peptide YydF (Probable). May process the precursor form of YydF to release the active peptide (Potential). {ECO:0000305}. |
| Temperature Dependency |
|
| PH Dependency |
|
| Pathway |
|
| nucleotide Binding |
|
| Features |
Active site (1); Chain (1); Metal binding (2); Sequence conflict (1); Transmembrane (5) |
| Keywords |
Cell membrane;Hydrolase;Membrane;Metal-binding;Metalloprotease;Protease;Reference proteome;Transmembrane;Transmembrane helix;Zinc |
| Interact With |
|
| Induction |
INDUCTION: Transcriptionally repressed by rok. |
| Subcellular Location |
SUBCELLULAR LOCATION: Cell membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}. |
| Modified Residue |
|
| Post Translational Modification |
|
| Signal Peptide |
|
| Structure 3D |
|
| Cross Reference PDB |
- |
| Mapped Pubmed ID |
- |
| Motif |
|
| Gene Encoded By |
|
| Mass |
29,942 |
| Kinetics |
|
| Metal Binding |
METAL 106; /note=Zinc; catalytic; /evidence=ECO:0000255|PROSITE-ProRule:PRU10095; METAL 110; /note=Zinc; catalytic; /evidence=ECO:0000255|PROSITE-ProRule:PRU10095 |
| Rhea ID |
|
| Cross Reference Brenda |
|