| IED ID | IndEnz0002012469 |
| Enzyme Type ID | protease012469 |
| Protein Name |
Abasic site processing protein YoqW EC 3.4.-.- |
| Gene Name | yoqW BSU20490 |
| Organism | Bacillus subtilis (strain 168) |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Firmicutes Bacilli Bacillales Bacillaceae Bacillus Bacillus subtilis group Bacillus subtilis Bacillus subtilis subsp. subtilis Bacillus subtilis (strain 168) |
| Enzyme Sequence | MCGRFTLFSEFDDIIEQFNIDQFLPEGEYHPSYNVAPSQNILTIINDGSNNRLGKLRWGLIPPWAKDEKIGYKMINARAETLSEKPSFRKPLVSKRCIIPADSFYEWKRLDPKTKIPMRIKLKSSNLFAFAGLYEKWNTPEGNPLYTCTIITTKPNELMEDIHDRMPVILTDENEKEWLNPKNTDPDYLQSLLQPYDADDMEAYQVSSLVNSPKNNSPELIESH |
| Enzyme Length | 224 |
| Uniprot Accession Number | O31916 |
| Absorption | |
| Active Site | ACT_SITE 2; /note=Nucleophile; /evidence=ECO:0000250|UniProtKB:Q96FZ2 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.-.- |
| Enzyme Function | FUNCTION: Sensor of abasic sites in single-stranded DNA (ssDNA) required to preserve genome integrity by promoting error-free repair of abasic sites. Recognizes and binds abasic sites in ssDNA at replication forks and chemically modifies the lesion by forming a covalent cross-link with DNA: forms a stable thiazolidine linkage between a ring-opened abasic site and the alpha-amino and sulfhydryl substituents of its N-terminal catalytic cysteine residue (By similarity). May act as a protease: mediates autocatalytic processing of its N-terminal methionine in order to expose the catalytic cysteine (By similarity). {ECO:0000250|UniProtKB:P76318, ECO:0000250|UniProtKB:Q8R1M0}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (1); Chain (1); Initiator methionine (1); Modified residue (1); Site (2) |
| Keywords | Covalent protein-DNA linkage;DNA damage;DNA-binding;Hydrolase;Protease;Reference proteome;SOS response |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | MOD_RES 2; /note=Thiazolidine linkage to a ring-opened DNA abasic site; /evidence=ECO:0000250|UniProtKB:P76318 |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 25,949 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |