| IED ID | IndEnz0002012480 |
| Enzyme Type ID | protease012480 |
| Protein Name |
Tumor necrosis factor receptor superfamily member 23 Decoy TRAIL receptor 1 TNF receptor family member SOB TNF receptor homolog 1 Tumor necrosis factor receptor p60 homolog 1 |
| Gene Name | Tnfrsf23 Dctrailr1 Tnfrh1 Tnfrsf1al1 |
| Organism | Mus musculus (Mouse) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Glires (Rodents and rabbits) Rodentia Myomorpha (mice and others) Muroidea Muridae Murinae Mus Mus Mus musculus (Mouse) |
| Enzyme Sequence | MVTFSHVSSLSHWFLLLLLLNLFLPVIFAMPESYSFNCPDGEYQSNDVCCKTCPSGTFVKAPCKIPHTQGQCEKCHPGTFTGKDNGLHDCELCSTCDKDQNMVADCSATSDRKCECQIGLYYYDPKFPESCRPCTKCPQGIPVLQECNSTANTVCSSSVSNPRNWLFLLMLIVFCI |
| Enzyme Length | 176 |
| Uniprot Accession Number | Q9ER63 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Receptor for the cytotoxic ligand TRAIL. Lacks a cytoplasmic death domain and hence is not capable of inducing apoptosis. May protect cells against TRAIL mediated apoptosis through ligand competition. Cannot induce the NF-kappa-B pathway. {ECO:0000269|PubMed:12466268}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (9); Glycosylation (1); Lipidation (1); Propeptide (1); Repeat (3); Signal peptide (1) |
| Keywords | Cell membrane;Disulfide bond;GPI-anchor;Glycoprotein;Lipoprotein;Membrane;Receptor;Reference proteome;Repeat;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cell membrane {ECO:0000269|PubMed:12466268}; Lipid-anchor, GPI-anchor {ECO:0000269|PubMed:12466268}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..29 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 12102730; 12473685; 16141072; 16602821; 19226377; 22595876; |
| Motif | |
| Gene Encoded By | |
| Mass | 19,595 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |