| IED ID |
IndEnz0002012612 |
| Enzyme Type ID |
protease012612 |
| Protein Name |
UPF0758 protein Ppro_3582
|
| Gene Name |
Ppro_3582 |
| Organism |
Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1) |
| Taxonomic Lineage |
cellular organisms
Bacteria
Proteobacteria
delta/epsilon subdivisions
Deltaproteobacteria
Desulfuromonadales
Desulfuromonadaceae
Pelobacter
Pelobacter propionicus
Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
|
| Enzyme Sequence |
MCPGIREWPEDERPREKMLRKGAASLSDAELLALIIRTGDTATGKSAIDLGRELISLFGSSLRELGSADMAEITAIKGMGMAKAAGVKAAFTLASRFQGRRLENLDRFTSPRQVFDYFHYELRDCRREYFLVLLLDGKNRIIRRVQVSEGSLNQSIVHPREVFCQAVKESAAAVILVHNHPTGDPTPSQEDIAITRRLKEAGEIMGIRVLDHIIIGDGEYLSFVERGVL |
| Enzyme Length |
229 |
| Uniprot Accession Number |
A1AV03 |
| Absorption |
|
| Active Site |
|
| Activity Regulation |
|
| Binding Site |
|
| Calcium Binding |
|
| catalytic Activity |
|
| DNA Binding |
|
| EC Number |
|
| Enzyme Function |
|
| Temperature Dependency |
|
| PH Dependency |
|
| Pathway |
|
| nucleotide Binding |
|
| Features |
Chain (1); Domain (1); Metal binding (3); Motif (1); Region (1) |
| Keywords |
Hydrolase;Metal-binding;Metalloprotease;Protease;Reference proteome;Zinc |
| Interact With |
|
| Induction |
|
| Subcellular Location |
|
| Modified Residue |
|
| Post Translational Modification |
|
| Signal Peptide |
|
| Structure 3D |
|
| Cross Reference PDB |
- |
| Mapped Pubmed ID |
- |
| Motif |
MOTIF 178..191; /note=JAMM motif; /evidence=ECO:0000255|PROSITE-ProRule:PRU01182 |
| Gene Encoded By |
|
| Mass |
25,495 |
| Kinetics |
|
| Metal Binding |
METAL 178; /note=Zinc; catalytic; /evidence=ECO:0000255|PROSITE-ProRule:PRU01182; METAL 180; /note=Zinc; catalytic; /evidence=ECO:0000255|PROSITE-ProRule:PRU01182; METAL 191; /note=Zinc; catalytic; /evidence=ECO:0000255|PROSITE-ProRule:PRU01182 |
| Rhea ID |
|
| Cross Reference Brenda |
|