| IED ID | IndEnz0002012633 |
| Enzyme Type ID | protease012633 |
| Protein Name |
Kunitz-like toxin PcKuz2 Kunitz-type serine protease inhibitor PcKuz2 PI-sphenopitoxin-Pc1b PI-SPTX-Pc1b |
| Gene Name | |
| Organism | Palythoa caribaeorum (White encrusting zoanthid coral) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Cnidaria Anthozoa (anthozoans) Hexacorallia Zoantharia (zoanthids) Sphenopidae Palythoa Palythoa caribaeorum (White encrusting zoanthid coral) |
| Enzyme Sequence | CKIPANAGNCNNHQERWFYNSHNRKCETFLYSGCGANPNNFKSEKQCESTC |
| Enzyme Length | 51 |
| Uniprot Accession Number | P0DQR0 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Weak serine protease inhibitor that has been tested on both trypsin and elastase (PubMed:29285938). In vivo, is not lethal to zebrafish larvae (PubMed:29285938). {ECO:0000269|PubMed:29285938}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (3) |
| Keywords | Disulfide bond;Nematocyst;Protease inhibitor;Secreted;Serine protease inhibitor |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000305}. Nematocyst {ECO:0000305}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 5,845 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |