| IED ID | IndEnz0002012639 |
| Enzyme Type ID | protease012639 |
| Protein Name |
Protein UmuD EC 3.4.21.- Cleaved into: Protein UmuD' |
| Gene Name | umuD Z1946 ECs1678 |
| Organism | Escherichia coli O157:H7 |
| Taxonomic Lineage | cellular organisms Bacteria Proteobacteria Gammaproteobacteria Enterobacterales Enterobacteriaceae Escherichia Escherichia coli Escherichia coli O157:H7 |
| Enzyme Sequence | MLFIKPADLREIVTFPLFSDLVQCGFPSPAADYVEQRIDLNQLLIQHPSATYFVKASGDSMIDGGISDGDLLIVDSAITASHGDIVIAAVDGEFTVKKLQLRPTVQLIPMNSAYSPITISSEDTLDVFGVVIHVVKAMR |
| Enzyme Length | 139 |
| Uniprot Accession Number | P0AG12 |
| Absorption | |
| Active Site | ACT_SITE 60; /note=For autocatalytic cleavage activity; /evidence=ECO:0000250; ACT_SITE 97; /note=For autocatalytic cleavage activity; /evidence=ECO:0000250 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.21.- |
| Enzyme Function | FUNCTION: Involved in UV protection and mutation. Essential for induced (or SOS) mutagenesis. May modify the DNA replication machinery to allow bypass synthesis across a damaged template (By similarity). {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (2); Chain (2); Site (1) |
| Keywords | Autocatalytic cleavage;DNA damage;DNA repair;Hydrolase;Protease;Reference proteome;SOS mutagenesis;SOS response;Serine protease |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 15,063 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |