IED ID | IndEnz0002012639 |
Enzyme Type ID | protease012639 |
Protein Name |
Protein UmuD EC 3.4.21.- Cleaved into: Protein UmuD' |
Gene Name | umuD Z1946 ECs1678 |
Organism | Escherichia coli O157:H7 |
Taxonomic Lineage | cellular organisms Bacteria Proteobacteria Gammaproteobacteria Enterobacterales Enterobacteriaceae Escherichia Escherichia coli Escherichia coli O157:H7 |
Enzyme Sequence | MLFIKPADLREIVTFPLFSDLVQCGFPSPAADYVEQRIDLNQLLIQHPSATYFVKASGDSMIDGGISDGDLLIVDSAITASHGDIVIAAVDGEFTVKKLQLRPTVQLIPMNSAYSPITISSEDTLDVFGVVIHVVKAMR |
Enzyme Length | 139 |
Uniprot Accession Number | P0AG12 |
Absorption | |
Active Site | ACT_SITE 60; /note=For autocatalytic cleavage activity; /evidence=ECO:0000250; ACT_SITE 97; /note=For autocatalytic cleavage activity; /evidence=ECO:0000250 |
Activity Regulation | |
Binding Site | |
Calcium Binding | |
catalytic Activity | |
DNA Binding | |
EC Number | 3.4.21.- |
Enzyme Function | FUNCTION: Involved in UV protection and mutation. Essential for induced (or SOS) mutagenesis. May modify the DNA replication machinery to allow bypass synthesis across a damaged template (By similarity). {ECO:0000250}. |
Temperature Dependency | |
PH Dependency | |
Pathway | |
nucleotide Binding | |
Features | Active site (2); Chain (2); Site (1) |
Keywords | Autocatalytic cleavage;DNA damage;DNA repair;Hydrolase;Protease;Reference proteome;SOS mutagenesis;SOS response;Serine protease |
Interact With | |
Induction | |
Subcellular Location | |
Modified Residue | |
Post Translational Modification | |
Signal Peptide | |
Structure 3D | |
Cross Reference PDB | - |
Mapped Pubmed ID | - |
Motif | |
Gene Encoded By | |
Mass | 15,063 |
Kinetics | |
Metal Binding | |
Rhea ID | |
Cross Reference Brenda |