| IED ID | IndEnz0002012663 |
| Enzyme Type ID | protease012663 |
| Protein Name |
Kunitz-type serine protease inhibitor BmKTT-1 Delta-KTx 2.4 |
| Gene Name | |
| Organism | Mesobuthus martensii (Manchurian scorpion) (Buthus martensii) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Ecdysozoa Panarthropoda Arthropoda Chelicerata Arachnida Scorpiones Buthida Buthoidea Buthidae Mesobuthus Mesobuthus martensii (Manchurian scorpion) (Buthus martensii) |
| Enzyme Sequence | QKDCSLPVDTGRGKGWFLRYYYNKNSKTCESFIYGGVGGNKNNFLNIENCCKICKAKNC |
| Enzyme Length | 59 |
| Uniprot Accession Number | P0DJ49 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Dual-function toxin that completely inhibits trypsin activity at a molar ratio of 1:1 (dissociation constant of 136 nM) and that inhibits mKv1.3/KCNA3 potassium channel currents with an IC(50) of 129.7 nM. {ECO:0000269|PubMed:22354971}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (3); Domain (1); Site (1) |
| Keywords | Disulfide bond;Ion channel impairing toxin;Potassium channel impairing toxin;Protease inhibitor;Secreted;Serine protease inhibitor;Toxin;Voltage-gated potassium channel impairing toxin |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000250}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 6,693 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |