| IED ID | IndEnz0002012666 |
| Enzyme Type ID | protease012666 |
| Protein Name |
Snake venom metalloproteinase acutolysin-C SVMP EC 3.4.24.- Hemorrhagin III |
| Gene Name | |
| Organism | Deinagkistrodon acutus (Hundred-pace snake) (Agkistrodon acutus) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Sauropsida Sauria (diapsids) Lepidosauria (lepidosaurs) Squamata (squamates) Bifurcata (split-tongued squamates) Unidentata Episquamata Toxicofera Serpentes (snakes) Colubroidea Viperidae Crotalinae (pit vipers) Deinagkistrodon Deinagkistrodon acutus (Hundred-pace snake) (Agkistrodon acutus) |
| Enzyme Sequence | PAPQTSIELFLIVDHSMYAKYNSNSSKITTTLKARVNIMNAIYSSLNLVITLSGIEMWSAADLITVQSSSRNTLKLFASWRETDLLKRTSNDNAQLLTATNFNGNTVGLAYLKTMCNSKYSVGLIQDHSAIPLLMAVTMAHELGHNLGMNHDGAGCSCATCIMAPVLSSGPAKSFSDCSKHDYQSFLTIHKPQCLLN |
| Enzyme Length | 197 |
| Uniprot Accession Number | P60244 |
| Absorption | |
| Active Site | ACT_SITE 142 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.24.- |
| Enzyme Function | FUNCTION: This protein is an alkaline zinc metalloprotease from snake venom that possesses weak hemorrhagic activity. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (1); Beta strand (7); Chain (1); Disulfide bond (3); Domain (1); Glycosylation (1); Helix (8); Metal binding (3); Turn (2) |
| Keywords | 3D-structure;Disulfide bond;Glycoprotein;Hemorrhagic toxin;Hemostasis impairing toxin;Hydrolase;Metal-binding;Metalloprotease;Protease;Secreted;Toxin;Zinc |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | X-ray crystallography (1) |
| Cross Reference PDB | 1QUA; |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 21,437 |
| Kinetics | |
| Metal Binding | METAL 141; /note=Zinc; catalytic; METAL 145; /note=Zinc; catalytic; METAL 151; /note=Zinc; catalytic |
| Rhea ID | |
| Cross Reference Brenda |