IED ID | IndEnz0002012696 |
Enzyme Type ID | protease012696 |
Protein Name |
Mitochondrial inner membrane protease subunit 1 EC 3.4.21.- IMP1-like protein |
Gene Name | Immp1l |
Organism | Mus musculus (Mouse) |
Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Glires (Rodents and rabbits) Rodentia Myomorpha (mice and others) Muroidea Muridae Murinae Mus Mus Mus musculus (Mouse) |
Enzyme Sequence | MLRGVLGKAFRLAGYTIQYGCIAHCAFEYVGGVVMCSGPSMEPTIQNSDIVFAENLSRHFYGIQRGDIVIAKSPSDPKSNICKRVIGLEGDKILSTSPSDVFKSRSYVPTGHVWLEGDNLQNSTDSRYYGPIPYGLIRGRIFFKIWPFSDFGFLRDSPNGQRFSDD |
Enzyme Length | 166 |
Uniprot Accession Number | Q9CQU8 |
Absorption | |
Active Site | ACT_SITE 40; /evidence=ECO:0000250; ACT_SITE 83; /evidence=ECO:0000250 |
Activity Regulation | |
Binding Site | |
Calcium Binding | |
catalytic Activity | |
DNA Binding | |
EC Number | 3.4.21.- |
Enzyme Function | FUNCTION: Catalyzes the removal of transit peptides required for the targeting of proteins from the mitochondrial matrix, across the inner membrane, into the inter-membrane space. Known to process the nuclear encoded protein DIABLO (By similarity). {ECO:0000250}. |
Temperature Dependency | |
PH Dependency | |
Pathway | |
nucleotide Binding | |
Features | Active site (2); Chain (1); Sequence conflict (2) |
Keywords | Hydrolase;Membrane;Mitochondrion;Mitochondrion inner membrane;Protease;Reference proteome |
Interact With | |
Induction | |
Subcellular Location | SUBCELLULAR LOCATION: Mitochondrion inner membrane {ECO:0000250}. |
Modified Residue | |
Post Translational Modification | |
Signal Peptide | |
Structure 3D | |
Cross Reference PDB | - |
Mapped Pubmed ID | 10725249; 11217851; 12466851; 14610273; 15814844; 16450175; 16919269; 18799693; 19474196; 21677750; |
Motif | |
Gene Encoded By | |
Mass | 18,502 |
Kinetics | |
Metal Binding | |
Rhea ID | |
Cross Reference Brenda |