| IED ID | IndEnz0002012697 |
| Enzyme Type ID | protease012697 |
| Protein Name |
Serine protease inhibitor Kazal-type 4 MPGC60 protein Peptide PEC-60 homolog |
| Gene Name | Spink4 Mpgc60 |
| Organism | Mus musculus (Mouse) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Glires (Rodents and rabbits) Rodentia Myomorpha (mice and others) Muroidea Muridae Murinae Mus Mus Mus musculus (Mouse) |
| Enzyme Sequence | MAMHLWLVTLTLVPLLGMDRELMVSAGSLVFPRMPFCEHMAELPNCPQTPNLICGTDGLTYENECHLCLTRMKTMKDIQIMKDGQC |
| Enzyme Length | 86 |
| Uniprot Accession Number | O35679 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (3); Domain (1); Sequence conflict (1); Signal peptide (1); Site (1) |
| Keywords | Disulfide bond;Protease inhibitor;Reference proteome;Secreted;Serine protease inhibitor;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000250}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..26; /evidence=ECO:0000250 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 14610273; 16602821; 17062627; 18554416; 19549527; 20562862; 21267068; |
| Motif | |
| Gene Encoded By | |
| Mass | 9,729 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |