| IED ID | IndEnz0002012698 |
| Enzyme Type ID | protease012698 |
| Protein Name |
Protease B inhibitor 2 Proteinase inhibitor I B 2 |
| Gene Name | PBI2 YNL015W N2844 |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Fungi Dikarya Ascomycota saccharomyceta Saccharomycotina (true yeasts) Saccharomycetes Saccharomycetales Saccharomycetaceae Saccharomyces Saccharomyces cerevisiae (Baker's yeast) Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) |
| Enzyme Sequence | MTKNFIVTLKKNTPDVEAKKFLDSVHHAGGSIVHEFDIIKGYTIKVPDVLHLNKLKEKHNDVIENVEEDKEVHTN |
| Enzyme Length | 75 |
| Uniprot Accession Number | P0CT04 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Cytosolic inhibitor of vacuolar proteinase B (yscB), probably regulating protease B activity during limited proteolysis. PBI2 is a component of the LMA1 complex, which is involved in the facilitation of vesicle fusion such as homotypic vacuole and ER-derived COPII vesicle fusion with the Golgi. {ECO:0000269|PubMed:12914955, ECO:0000269|PubMed:2015812, ECO:0000269|PubMed:9015301, ECO:0000269|PubMed:9159115, ECO:0000269|PubMed:9657146}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Initiator methionine (1); Modified residue (1); Sequence conflict (1) |
| Keywords | Cytoplasm;Direct protein sequencing;Phosphoprotein;Protease inhibitor;Protein transport;Reference proteome;Serine protease inhibitor;Transport |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000269|PubMed:1100120, ECO:0000269|PubMed:14562095, ECO:0000269|PubMed:9159115}. |
| Modified Residue | MOD_RES 74; /note="Phosphothreonine"; /evidence="ECO:0007744|PubMed:17330950, ECO:0007744|PubMed:19779198" |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 10024450; 11283351; 11823419; 14660704; 19494127; 19882662; 2037077; 22842922; 23825934; 23874186; 27693354; 381308; |
| Motif | |
| Gene Encoded By | |
| Mass | 8,590 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |