Detail Information for IndEnz0002012715
IED ID IndEnz0002012715
Enzyme Type ID protease012715
Protein Name Lipoprotein signal peptidase
EC 3.4.23.36
Prolipoprotein signal peptidase
Signal peptidase II
SPase II
Gene Name lspA lsp TP_0978
Organism Treponema pallidum (strain Nichols)
Taxonomic Lineage cellular organisms Bacteria Spirochaetes Spirochaetia Spirochaetales Treponemataceae Treponema Treponema pallidum Treponema pallidum subsp. pallidum (syphilis treponeme) Treponema pallidum (strain Nichols)
Enzyme Sequence MKLTRIQKEKWIPLFAAGLVVVLDQCAKLLVGAYVPTNTSGVRVLGDFVRIVHVYNVGAAFSIGHQLNQVLRTLVLGIVPLIIMFLIVFSYFRTDAFCPVQRWAVSGIIGGGIGNLIDRFLRPNGVLDFIDVKFFGIFGFERWPAFNIADAVIMTCGLLLIISFIKQEKEISSQPSCNETGGVFRT
Enzyme Length 186
Uniprot Accession Number O83943
Absorption
Active Site ACT_SITE 128; /evidence=ECO:0000255|HAMAP-Rule:MF_00161; ACT_SITE 150; /evidence=ECO:0000255|HAMAP-Rule:MF_00161
Activity Regulation
Binding Site
Calcium Binding
catalytic Activity CATALYTIC ACTIVITY: Reaction=Release of signal peptides from bacterial membrane prolipoproteins. Hydrolyzes -Xaa-Yaa-Zaa-|-(S,diacylglyceryl)Cys-, in which Xaa is hydrophobic (preferably Leu), and Yaa (Ala or Ser) and Zaa (Gly or Ala) have small, neutral side chains.; EC=3.4.23.36; Evidence={ECO:0000255|HAMAP-Rule:MF_00161};
DNA Binding
EC Number 3.4.23.36
Enzyme Function FUNCTION: This protein specifically catalyzes the removal of signal peptides from prolipoproteins. {ECO:0000255|HAMAP-Rule:MF_00161}.
Temperature Dependency
PH Dependency
Pathway PATHWAY: Protein modification; lipoprotein biosynthesis (signal peptide cleavage). {ECO:0000255|HAMAP-Rule:MF_00161}.
nucleotide Binding
Features Active site (2); Chain (1); Erroneous initiation (1); Transmembrane (4)
Keywords Aspartyl protease;Cell inner membrane;Cell membrane;Hydrolase;Membrane;Protease;Reference proteome;Transmembrane;Transmembrane helix
Interact With
Induction
Subcellular Location SUBCELLULAR LOCATION: Cell inner membrane {ECO:0000255|HAMAP-Rule:MF_00161}; Multi-pass membrane protein {ECO:0000255|HAMAP-Rule:MF_00161}.
Modified Residue
Post Translational Modification
Signal Peptide
Structure 3D
Cross Reference PDB -
Mapped Pubmed ID 18509523;
Motif
Gene Encoded By
Mass 20,596
Kinetics
Metal Binding
Rhea ID
Cross Reference Brenda