| IED ID | IndEnz0002012719 |
| Enzyme Type ID | protease012719 |
| Protein Name |
Four-domain proteases inhibitor McaPI |
| Gene Name | |
| Organism | Melithaea caledonica |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Cnidaria Anthozoa (anthozoans) Octocorallia Alcyonacea (soft corals) Scleraxonia Melithaeidae Melithaea Melithaea caledonica |
| Enzyme Sequence | CDLACSLIYAPVCGSDGKTYPSECSMEATACIDEVVITKVHDGPCETKCSAACTKEYNPQCGTDGVTYANPCTLEYAKCKSDGEITFDHAGPCKPKCPTVCTLEYNPQCGTDGRTYGNPCQLKVAECESDGRITLDHPGECDACSLKKVVGPCRGAFRRYYFDSVSGKCEEFVYGGCGGNDNNFKTLDACQKRCMEE |
| Enzyme Length | 197 |
| Uniprot Accession Number | P82968 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Inhibits trypsin, kallikrein, subtilisin Carlsberg, human leukocyte elastase, porcine pancreatic elastase and chymotrypsin. Two domains are for the inhibition of chymotrypsin. {ECO:0000269|Ref.1}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (12); Domain (4); Natural variant (1); Site (4) |
| Keywords | Direct protein sequencing;Disulfide bond;Protease inhibitor;Repeat;Serine protease inhibitor |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 21,248 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |