| IED ID | IndEnz0002012731 |
| Enzyme Type ID | protease012731 |
| Protein Name |
Serine protease 30 EC 3.4.21.- Distal intestinal serine protease Transmembrane serine protease 8 |
| Gene Name | Prss30 Disp Tmprss8 |
| Organism | Mus musculus (Mouse) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Glires (Rodents and rabbits) Rodentia Myomorpha (mice and others) Muroidea Muridae Murinae Mus Mus Mus musculus (Mouse) |
| Enzyme Sequence | MESRARCIFLLLLQILTRARGDILPSVCGHSRDAGKIVGGQDALEGQWPWQVSLWITEDGHICGGSLIHEVWVLTAAHCFRRSLNPSFYHVKVGGLTLSLLEPHSTLVAVRNIFVHPTYLWADASSGDIALVQLDTPLRPSQFTPVCLPAAQTPLTPGTVCWVTGWGATQERDMASVLQELAVPLLDSEDCEKMYHTQGSSLSGERIIQSDMLCAGYVEGQKDSCQGDSGGPLVCSINSSWTQVGITSWGIGCARPYRPGVYTRVPTYVDWIQRILAENHSDAYGYHSSASAAYQMLLPVLLAVALPGSL |
| Enzyme Length | 310 |
| Uniprot Accession Number | Q9QYZ9 |
| Absorption | |
| Active Site | ACT_SITE 78; /note=Charge relay system; /evidence=ECO:0000250|UniProtKB:P49863; ACT_SITE 128; /note=Charge relay system; /evidence=ECO:0000250|UniProtKB:P49863; ACT_SITE 229; /note=Charge relay system; /evidence=ECO:0000250|UniProtKB:P49863 |
| Activity Regulation | ACTIVITY REGULATION: Inhibited by aprotinin, leupeptin, benzamidine and soybean trypsin inhibitor. Partially inhibited by PMSF and DFP (By similarity). {ECO:0000250|UniProtKB:P83748}. |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.21.- |
| Enzyme Function | FUNCTION: Selectively cleaves synthetic peptide substrates of trypsin. Activates the epithelial sodium channel ENaC (By similarity). {ECO:0000250|UniProtKB:P83748}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (3); Chain (1); Disulfide bond (4); Domain (1); Glycosylation (2); Lipidation (1); Propeptide (2); Sequence conflict (1); Signal peptide (1) |
| Keywords | Cell membrane;Disulfide bond;GPI-anchor;Glycoprotein;Hydrolase;Ion transport;Lipoprotein;Membrane;Protease;Reference proteome;Serine protease;Signal;Sodium;Sodium transport;Transport;Zymogen |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cell membrane {ECO:0000305}; Lipid-anchor, GPI-anchor {ECO:0000305}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..21; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 11217851; 14583634; 21267068; 21677750; |
| Motif | |
| Gene Encoded By | |
| Mass | 33,707 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |