| IED ID | IndEnz0002012747 |
| Enzyme Type ID | protease012747 |
| Protein Name |
Movement protein p6 6 kDa protein p6 |
| Gene Name | ORF2 |
| Organism | Beet yellows virus (isolate Ukraine) (BYV) (Sugar beet yellows virus) |
| Taxonomic Lineage | Viruses Riboviria Orthornavirae Kitrinoviricota Alsuviricetes Martellivirales Closteroviridae Closterovirus Beet yellows virus Beet yellows virus (isolate Ukraine) (BYV) (Sugar beet yellows virus) |
| Enzyme Sequence | MDCVLRSYLLLAFGFLICLFLFCLVVFIWFVYKQILFRTTAQSNEARHNHSTVV |
| Enzyme Length | 54 |
| Uniprot Accession Number | Q08542 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Transports viral genome to neighboring plant cells directly through plasmosdesmata, without any budding. The movement protein allows efficient cell to cell propagation, by bypassing the host cell wall barrier. Two movement proteins, p6, Hsp70h and three structural proteins, CP, CPm, and P64 are essential for cell-cell movement. Also plays a role in virion formation. Together with CPm and p64, encapsidates the 5'-terminal portion of the viral genome (By similarity). {ECO:0000250, ECO:0000269|PubMed:15016890}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (1); Mutagenesis (13); Topological domain (2); Transmembrane (1) |
| Keywords | Disulfide bond;Host endoplasmic reticulum;Host membrane;Membrane;Reference proteome;Transmembrane;Transmembrane helix;Transport;Viral movement protein |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Host rough endoplasmic reticulum membrane {ECO:0000305}; Single-pass type III membrane protein {ECO:0000305}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 6,389 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |