| IED ID | IndEnz0002012762 |
| Enzyme Type ID | protease012762 |
| Protein Name |
Papain inhibitor SPI |
| Gene Name | pi |
| Organism | Streptomyces mobaraensis (Streptoverticillium mobaraense) |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Actinobacteria Actinomycetia (high G+C Gram-positive bacteria) Streptomycetales Streptomycetaceae Streptomyces Streptomyces mobaraensis (Streptoverticillium mobaraense) |
| Enzyme Sequence | MREFRRVRRVRFAACALVAAATGITLAAGPASADIPIGQKMTGKMTYYTDKGYGACGTPIDASSQDLVAIPAAWWTTPNPNNDPLCRGVSVEVSYNGRTIRVPVRDKCPSCDRTHIDLSQAAFAKLAPLDRGVVNGITWKFVR |
| Enzyme Length | 143 |
| Uniprot Accession Number | P86242 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Stress protein produced under hyperthermal stress conditions. Serves as a glutamine and lysine donor substrate for transglutaminase. Inhibits the cysteine proteases papain and bromelain as well as the bovine serine protease trypsin. Has hardly any or no effect on subtilisin, bovine chymotrypsin, proteinase K from T.album, transglutaminase-activating metalloproteinase (TAMEP) from S.mobaraensis, dispase from B.polymyxa, thermolysin from B.thermoproteolyticus or collagenase from C.histolyticum. {ECO:0000269|PubMed:21715969}. |
| Temperature Dependency | BIOPHYSICOCHEMICAL PROPERTIES: Temperature dependence: Thermostable. Activity is stable between 20-40 degrees Celsius. Retains about 70% activity after 60 min at 100 degrees Celsius. {ECO:0000269|PubMed:21715969}; |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (9); Chain (1); Helix (5); Signal peptide (1); Turn (2) |
| Keywords | 3D-structure;Direct protein sequencing;Protease inhibitor;Secreted;Serine protease inhibitor;Signal;Thiol protease inhibitor |
| Interact With | |
| Induction | INDUCTION: By heat stress. {ECO:0000269|PubMed:21715969}. |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:21715969}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..33; /evidence=ECO:0000269|PubMed:21715969 |
| Structure 3D | X-ray crystallography (2) |
| Cross Reference PDB | 5NTB; 6GMG; |
| Mapped Pubmed ID | 29430769; 30318745; |
| Motif | |
| Gene Encoded By | |
| Mass | 15,471 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |