| IED ID | IndEnz0002012782 |
| Enzyme Type ID | protease012782 |
| Protein Name |
Basic phospholipase A2 homolog Vur-S49 svPLA2 homolog |
| Gene Name | |
| Organism | Vipera renardi (Steppe viper) (Vipera ursinii renardi) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Sauropsida Sauria (diapsids) Lepidosauria (lepidosaurs) Squamata (squamates) Bifurcata (split-tongued squamates) Unidentata Episquamata Toxicofera Serpentes (snakes) Colubroidea Viperidae Viperinae (vipers) Vipera Vipera renardi (Steppe viper) (Vipera ursinii renardi) |
| Enzyme Sequence | MRALWIVAVCLIGVEGSMIEFGKMIQEETEKNPITSYSLYGCHCGLGSKGKPKDATDRCCFVHSCCYAKLSDCSPKTNRYEYHRENGTIVCGSSTFCKKQICECDRAAAICFRENLKTYNKKYKVYLRFKCKGVPEKC |
| Enzyme Length | 138 |
| Uniprot Accession Number | F8QN50 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Snake venom phospholipase A2 homolog that lacks enzymatic activity (PubMed:25522251). Is able to suppress the acetylcholine (ACh)-evoked current mediated by alpha-7-similar nAChRs in L.stagnalis neurons (IC(50)=2.18 uM) (PubMed:25522251). This activity is only partially reversible and seems to be non-competitive (PubMed:25522251). {ECO:0000269|PubMed:25522251}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (7); Region (1); Signal peptide (1) |
| Keywords | Acetylcholine receptor inhibiting toxin;Disulfide bond;Neurotoxin;Postsynaptic neurotoxin;Secreted;Signal;Toxin |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:25522251}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..16; /evidence=ECO:0000250 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 15,659 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |