| IED ID | IndEnz0002012794 |
| Enzyme Type ID | protease012794 |
| Protein Name |
Gag-Pol polyprotein Pr180gag-pol Cleaved into: Integrase p46 IN EC 2.7.7.- EC 3.1.-.- Fragment |
| Gene Name | gag-pol |
| Organism | Mink cell focus-forming murine leukemia virus (isolate CI-3) |
| Taxonomic Lineage | Viruses Riboviria Pararnavirae Artverviricota Revtraviricetes Ortervirales Retroviridae Orthoretrovirinae Gammaretrovirus Murine leukemia virus unclassified Murine leukemia virus Mink cell focus-forming murine leukemia virus Mink cell focus-forming murine leukemia virus (isolate CI-3) |
| Enzyme Sequence | RNTPGPHGLTPYEILYGAPPPLVNFHDPDMSELTNSPSLQAHLQALQTVQREIWRPLAEAYRDRLDQPVIPHPFRTGDSVWVRRHQTKNSEPRWKGPYTVLLTTPTALKVDGIAAWIHAAHVKAATTPPAGTASGPTWKVQRSQNPLKIRLTRGAP |
| Enzyme Length | 156 |
| Uniprot Accession Number | P16103 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 2.7.7.-; 3.1.-.- |
| Enzyme Function | FUNCTION: Integrase catalyzes viral DNA integration into the host chromosome, by performing a series of DNA cutting and joining reactions. This enzyme activity takes place after virion entry into a cell and reverse transcription of the RNA genome in dsDNA. The first step in the integration process is 3' processing. This step requires a complex comprising the viral genome, matrix protein and integrase. This complex is called the pre-integration complex (PIC). The integrase protein removes 2 nucleotides from each 3' end of the viral DNA, leaving recessed CA OH's at the 3' ends. In the second step that requires cell division, the PIC enters cell nucleus. In the third step, termed strand transfer, the integrase protein joins the previously processed 3' ends to the 5' ends of strands of target cellular DNA at the site of integration. The last step is viral DNA integration into host chromosome (By similarity). {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (2); Non-terminal residue (1) |
| Keywords | DNA integration;Endonuclease;Hydrolase;Magnesium;Metal-binding;Nuclease;Nucleotidyltransferase;Transferase;Viral genome integration;Virus entry into host cell |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | PTM: Specific enzymatic cleavages by the viral protease yield mature proteins. The protease is released by autocatalytic cleavage. The polyprotein is cleaved during and after budding, this process is termed maturation (By similarity). {ECO:0000250}. |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 17,366 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |