| IED ID | IndEnz0002012815 |
| Enzyme Type ID | protease012815 |
| Protein Name |
Carboxypeptidase inhibitor TCI |
| Gene Name | |
| Organism | Rhipicephalus bursa (Tick) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Ecdysozoa Panarthropoda Arthropoda Chelicerata Arachnida Acari Parasitiformes Ixodida (ticks) Ixodoidea Ixodidae (hardbacked ticks) Rhipicephalinae Rhipicephalus Rhipicephalus Rhipicephalus bursa (Tick) |
| Enzyme Sequence | MAATLPVFAVVFFAMVLASSQANECVSKGFGCLPQSDCPQEARLSYGGCSTVCCDLSKLTGCKGKGGECNPLDRQCKELQAESASCGKGQKCCVWLH |
| Enzyme Length | 97 |
| Uniprot Accession Number | Q5EPH2 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Potent competitive inhibitor of metallo-carboxypeptidases CPA1, CPA2, CPB, CPN and TAF1a. Accelerates fibrinolysis in vitro and may contribute to the maintenance of host blood liquidity during feeding. {ECO:0000269|PubMed:15561703}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (5); Chain (1); Helix (6); Signal peptide (1) |
| Keywords | 3D-structure;Blood coagulation;Direct protein sequencing;Fibrinolysis;Hemostasis;Metalloenzyme inhibitor;Metalloprotease inhibitor;Protease inhibitor;Secreted;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..22; /evidence=ECO:0000269|PubMed:15561703 |
| Structure 3D | NMR spectroscopy (4); X-ray crystallography (5) |
| Cross Reference PDB | 1ZLH; 1ZLI; 2JTO; 2K2X; 2K2Y; 2K2Z; 3D4U; 3LMS; 3OSL; |
| Mapped Pubmed ID | 12162965; 15961103; 18558717; 18640980; 18722183; 20088943; 20880845; |
| Motif | |
| Gene Encoded By | |
| Mass | 10,189 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |