| IED ID | IndEnz0002012828 |
| Enzyme Type ID | protease012828 |
| Protein Name |
Ubiquitin carboxyl-terminal hydrolase 11 EC 3.4.19.12 Deubiquitinating enzyme 11 Ubiquitin thioesterase 11 Ubiquitin-specific-processing protease 11 |
| Gene Name | Usp11 |
| Organism | Rattus norvegicus (Rat) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Glires (Rodents and rabbits) Rodentia Myomorpha (mice and others) Muroidea Muridae Murinae Rattus Rattus norvegicus (Rat) |
| Enzyme Sequence | MAAVAADPAAAAVPASAEDRETQPEAMPDLDQQWRQIGNGRERPLRAGESWFLVEKHWYKQWEAYVKGGDQDASTFPGSINNSGLFEDQISWHLRERLVEGDDYVLLPAPAWNYLVSWYGLKDDQPPIERKVIELPGIRKVEVYPIELLLVQHSDMETALTIQFSYSDSVDLVLQTAREQFLVEPQEDTRLWTKNSEGSLDRLCNTQITLLDACLETGQLVIMETRNKDGTWPSAQLCGMNNMPDEDEDFQGQPGICGLTNLGNTCFMNSALQCLSNVPQLTEYFLNNRYLEELNFRNPLGMKGELAEAYADLVKQTWSGYHRSIVPNVFKNKVGHFASQFLGYQQHDSQELLSFLLDGLHEDLNRVKKKEYVELCNGAGRPDLEVAQEAWQNHKRRNDSVIVDTFHGLFKSTLVCPDCGNVSVTFDPFCYLSVPLPVCSRRVLEVFFVPMDPRRKPEQHRVVVPKKGNISDLCVALSTHTSVAPDKMIVADVFSHRFYKLYQLEDPLSGILDRDDIFVYEVTGRIEPVEGSRDDIVVPVYLRERTPSRDYNNSYYGLILFGHPLLVSVPRDRFSWEGLYNILMYRLSRYVTKPTSDDDDGDEKGDENEDEDVEDDSSSEEEKEEMSGPTDNDGTQESEQEQAGTSSGVTGRCPSLLDNSLHTSQWPPRRRRKQLFTLQTVNSNGTSDRTTSPEEAQTQPYIAMDWEPEMKRRYYDEVEAEGYVKHDCVGYMLKKNPVQLKECIKLFTTVETLEKENPWYCSSCKQHQLATKKLDLWMLPEVLIIHLKRFSFSKFSREKLDTLVQFPIRDLDFSEFVIKPKNESAPDLYKYDLIAVSNHYGGMRDGHYTTFACNKDSGQWHYFDDNSVSPVNENQIESKAAYVLFYQRQDVGRRQSQTASSETPTSPASSSTPNSDIMDVN |
| Enzyme Length | 921 |
| Uniprot Accession Number | Q5D006 |
| Absorption | |
| Active Site | ACT_SITE 266; /note=Nucleophile; /evidence=ECO:0000255|PROSITE-ProRule:PRU01035; ACT_SITE 847; /note=Proton acceptor; /evidence=ECO:0000255|PROSITE-ProRule:PRU01035 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Thiol-dependent hydrolysis of ester, thioester, amide, peptide and isopeptide bonds formed by the C-terminal Gly of ubiquitin (a 76-residue protein attached to proteins as an intracellular targeting signal).; EC=3.4.19.12; Evidence={ECO:0000250|UniProtKB:P51784}; |
| DNA Binding | |
| EC Number | 3.4.19.12 |
| Enzyme Function | FUNCTION: Protease that can remove conjugated ubiquitin from target proteins and polyubiquitin chains. Inhibits the degradation of target proteins by the proteasome. Cleaves preferentially 'Lys-6' and 'Lys-63'-linked ubiquitin chains. Has lower activity with 'Lys-11' and 'Lys-33'-linked ubiquitin chains, and extremely low activity with 'Lys-27', 'Lys-29' and 'Lys-48'-linked ubiquitin chains (in vitro). Plays a role in the regulation of pathways leading to NF-kappa-B activation. Plays a role in the regulation of DNA repair after double-stranded DNA breaks. Acts as a chromatin regulator via its association with the Polycomb group (PcG) multiprotein PRC1-like complex; may act by deubiquitinating components of the PRC1-like comple. Promotes cell proliferation by deubiquitinating phosphorylated E2F1x. {ECO:0000250|UniProtKB:P51784}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (2); Beta strand (9); Chain (1); Compositional bias (3); Domain (2); Helix (6); Modified residue (4); Region (3); Turn (3) |
| Keywords | 3D-structure;Acetylation;Chromosome;Cytoplasm;Hydrolase;Nucleus;Phosphoprotein;Protease;Reference proteome;Thiol protease;Ubl conjugation pathway |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Nucleus {ECO:0000250|UniProtKB:P51784}. Cytoplasm {ECO:0000250|UniProtKB:P51784}. Chromosome {ECO:0000250|UniProtKB:P51784}. Note=Predominantly nuclear. Associates with chromatin. {ECO:0000250|UniProtKB:P51784}. |
| Modified Residue | MOD_RES 194; /note=N6-acetyllysine; /evidence=ECO:0000250|UniProtKB:P51784; MOD_RES 596; /note=Phosphoserine; /evidence=ECO:0000250|UniProtKB:P51784; MOD_RES 692; /note=Phosphoserine; /evidence=ECO:0007744|PubMed:22673903; MOD_RES 906; /note=Phosphoserine; /evidence=ECO:0000250|UniProtKB:P51784 |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | X-ray crystallography (1) |
| Cross Reference PDB | 4MEM; |
| Mapped Pubmed ID | 26334325; |
| Motif | |
| Gene Encoded By | |
| Mass | 105,239 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |