| IED ID | IndEnz0002012833 |
| Enzyme Type ID | protease012833 |
| Protein Name |
Thrombin-like enzyme elegaxobin-2 SVTLE EC 3.4.21.- Elegaxobin II Fibrinogen-clotting enzyme Snake venom serine protease SVSP |
| Gene Name | |
| Organism | Protobothrops elegans (Elegant pitviper) (Trimeresurus elegans) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Sauropsida Sauria (diapsids) Lepidosauria (lepidosaurs) Squamata (squamates) Bifurcata (split-tongued squamates) Unidentata Episquamata Toxicofera Serpentes (snakes) Colubroidea Viperidae Crotalinae (pit vipers) Protobothrops Protobothrops elegans (Elegant pitviper) (Trimeresurus elegans) |
| Enzyme Sequence | VIGGDECNINEHPFLVLVYYDEYQCGGTLINEEWVLTAAHCDGENMEIHLGMHSKKVPNKDRRRRVPKEKFFCDSSKNYTKWNKDIMLIRLNRPVRKSAHIAPLSLPSSPPSVGSVCRIMGWGTISPTEETYPDVPHCANINLLDYEVCRAAYPELPATSRTLCAGILEGGKDSCGGDSGGPLICNGQFQGIVSWGGDPCAQPHEPGSYTNVFDHLDWIKGIIAGNTDATCPL |
| Enzyme Length | 233 |
| Uniprot Accession Number | P84787 |
| Absorption | |
| Active Site | ACT_SITE 40; /note=Charge relay system; /evidence=ECO:0000250|UniProtKB:P12544; ACT_SITE 85; /note=Charge relay system; /evidence=ECO:0000250|UniProtKB:P12544; ACT_SITE 179; /note=Charge relay system; /evidence=ECO:0000250|UniProtKB:P12544 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.21.- |
| Enzyme Function | FUNCTION: Thrombin-like snake venom serine protease that clots rabbit fibrinogen. Only the beta chain of fibrinogen (FGB) is cleaved, releasing fibrinopeptide B. Human and bovine fibrinogen are unaffected. Also cleaves Met-Lys and Arg-Ser bonds in heat-denatured bovine plasma kininogen to release Lys-bradykinin. {ECO:0000269|PubMed:12676434}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (3); Chain (1); Disulfide bond (6); Domain (1); Glycosylation (1) |
| Keywords | Blood coagulation cascade activating toxin;Direct protein sequencing;Disulfide bond;Glycoprotein;Hemostasis impairing toxin;Hydrolase;Hypotensive agent;Protease;Secreted;Serine protease;Toxin |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:12676434, ECO:0000269|PubMed:15500847}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 25,591 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |