| IED ID | IndEnz0002012838 |
| Enzyme Type ID | protease012838 |
| Protein Name |
Uncharacterized protein MTH_1463 ORF11 |
| Gene Name | MTH_1463 |
| Organism | Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) (Methanobacterium thermoautotrophicum) |
| Taxonomic Lineage | cellular organisms Archaea Euryarchaeota Methanomada group Methanobacteria Methanobacteriales Methanobacteriaceae Methanothermobacter Methanothermobacter thermautotrophicus (Methanobacterium thermoformicicum) Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) (Methanobacterium thermoautotrophicum) |
| Enzyme Sequence | MEVFVMSTSLGDEVIVMQSRSYSCGPAALATVLRNLGVNCTEAELAELAGTDESGTTMYGLIVAATSKGLRARGVKMELNDLRKNHIVFVKYGDTCHYTVIMSMDERNVTLADPALGRITVKREIFSRIFTGNVLVVERPCD |
| Enzyme Length | 142 |
| Uniprot Accession Number | Q50500 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Domain (1) |
| Keywords | Hydrolase;Protease;Reference proteome;Thiol protease |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 15,524 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |