| IED ID | IndEnz0002012845 |
| Enzyme Type ID | protease012845 |
| Protein Name |
26S proteasome non-ATPase regulatory subunit 14 EC 3.4.19.- 26S proteasome regulatory subunit rpn11 |
| Gene Name | rpn-11 K07D4.3 |
| Organism | Caenorhabditis elegans |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Ecdysozoa Nematoda (roundworms) Chromadorea Rhabditida Rhabditina Rhabditomorpha Rhabditoidea Rhabditidae Peloderinae Caenorhabditis Caenorhabditis elegans |
| Enzyme Sequence | MERFLRLGGLGGNLGTFGANPQDSNQVDTSETVYISSLALLKMLKHGRAGVPMEVMGLMLGEFVDDYTVNVIDVFAMPQSGTGVSVEAVDPVFQAKMLDMLKQTGRPEMVVGWYHSHPGFGCWLSGVDINTQQSFEALSDRAVAVVVDPIQSVKGKVVIDAFRTINPQSMALNQEPRQTTSNLGHLQKPSIQALIHGLNRHYYSIPIAYRTHDLEQKMLLNLNKLSWMDAVSVENYSKCGEQNKEHLKAMLKLAKNYKKALEDEKNMTDQELAIKNVGKMDPKRHIADEVSKMLNDNIVQSLAGMMATTSLQ |
| Enzyme Length | 312 |
| Uniprot Accession Number | O76577 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.19.- |
| Enzyme Function | FUNCTION: Metalloprotease component of the 26S proteasome that specifically cleaves 'Lys-63'-linked polyubiquitin chains. The 26S proteasome is involved in the ATP-dependent degradation of ubiquitinated proteins. The function of the 'Lys-63'-specific deubiquitination of the proteasome is unclear (By similarity). {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Domain (1); Metal binding (3); Motif (1) |
| Keywords | Hydrolase;Metal-binding;Metalloprotease;Protease;Proteasome;Reference proteome;Ubl conjugation pathway;Zinc |
| Interact With | O61792 |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 11559592; 11731503; 12437114; 12529635; 12679813; 14551910; 15084750; 15489339; 15791247; 17392428; 18182484; 18692475; 20351174; 21085631; 21177967; 21367940; 22500807; 22560298; 22634595; 23144747; 23604319; 23637632; 23800452; 25487147; 25635455; 26009280; 26351692; 27506200; 30140741; 31283754; |
| Motif | MOTIF 115..128; /note=JAMM motif; /evidence=ECO:0000255|PROSITE-ProRule:PRU01182 |
| Gene Encoded By | |
| Mass | 34,596 |
| Kinetics | |
| Metal Binding | METAL 115; /note=Zinc; catalytic; /evidence=ECO:0000255|PROSITE-ProRule:PRU01182; METAL 117; /note=Zinc; catalytic; /evidence=ECO:0000255|PROSITE-ProRule:PRU01182; METAL 128; /note=Zinc; catalytic; /evidence=ECO:0000255|PROSITE-ProRule:PRU01182 |
| Rhea ID | |
| Cross Reference Brenda |