| IED ID | IndEnz0002012853 |
| Enzyme Type ID | protease012853 |
| Protein Name |
Proteasome subunit alpha 20S proteasome alpha subunit Proteasome core protein PsmA |
| Gene Name | psmA M1627_1453 |
| Organism | Sulfolobus islandicus (strain M.16.27) |
| Taxonomic Lineage | cellular organisms Archaea TACK group Crenarchaeota Thermoprotei Sulfolobales Sulfolobaceae Sulfolobus Sulfolobus islandicus Sulfolobus islandicus (strain M.16.27) |
| Enzyme Sequence | MAFGPAAMGYDRAITIFSPDGSLYQVDYAFEAVKKGWTAIGIKSKSGVVIASEKRKAQSLLDVDSIEKVFLIDDHVGCSFAGLASDGRVLIDYARNIALQHRLIYDEPVSIDYLTKSVADVKQMYTQHGGVRPFGVALVIAGIDKSVPKLYMTEPSGQYMPYQAVAIGQGYYTATEFLEKNYKEDLTIEDTILLALKALSATLKPNEKLTPNTVEIGYASTQTGLFLKMTSEDKNMYLQKL |
| Enzyme Length | 241 |
| Uniprot Accession Number | C3N5R0 |
| Absorption | |
| Active Site | |
| Activity Regulation | ACTIVITY REGULATION: The formation of the proteasomal ATPase PAN-20S proteasome complex, via the docking of the C-termini of PAN into the intersubunit pockets in the alpha-rings, triggers opening of the gate for substrate entry. Interconversion between the open-gate and close-gate conformations leads to a dynamic regulation of the 20S proteasome proteolysis activity. {ECO:0000255|HAMAP-Rule:MF_00289}. |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Component of the proteasome core, a large protease complex with broad specificity involved in protein degradation. {ECO:0000255|HAMAP-Rule:MF_00289}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1) |
| Keywords | Cytoplasm;Proteasome |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000255|HAMAP-Rule:MF_00289}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 26,535 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |