| IED ID | IndEnz0002012872 |
| Enzyme Type ID | protease012872 |
| Protein Name |
Protein Sxy Competence activator Sxy |
| Gene Name | sxy tfoX yccR b0959 JW0942 |
| Organism | Escherichia coli (strain K12) |
| Taxonomic Lineage | cellular organisms Bacteria Proteobacteria Gammaproteobacteria Enterobacterales Enterobacteriaceae Escherichia Escherichia coli Escherichia coli (strain K12) |
| Enzyme Sequence | MKSLSYKRIYKSQEYLATLGTIEYRSLFGSYSLTVDDTVFAMVSDGELYLRACEQSAQYCVKHPPVWLTYKKCGRSVTLNYYRVDESLWRNQLKLVRLSKYSLDAALKEKSTRNTRERLKDLPNMSFHLEAILGEVGIKDVRALRILGAKMCWLRLRQQNSLVTEKILFMLEGAIIGIHEAALPVARRQELAEWADSLTPKQEFPAELE |
| Enzyme Length | 209 |
| Uniprot Accession Number | P75869 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Induces low levels of natural DNA uptake by inducing transcription of the competence genes (the CRP-S regulon) required for DNA transformation. Induction of the CRP-S regulon also requires Sxy-activated promoter (CRP-S), cAMP receptor protein (CRP) and cAMP (PubMed:17068078, PubMed:22532864). Induces CRP-S site-containing genes which are involved in genome maintenance and transcription or encoding transposases and toxin-antitoxin pairs (PubMed:19502395). {ECO:0000269|PubMed:17068078, ECO:0000269|PubMed:19502395, ECO:0000269|PubMed:22532864}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1) |
| Keywords | Activator;Competence;Reference proteome;Transcription;Transcription regulation |
| Interact With | P75960; P42184 |
| Induction | INDUCTION: Not expressed by conditions that usually induce expression in other bacteria, such as amino acid starvation, antibiotics or addition of chitin. Induces its own transcription by a mechanism that requires CRP, cAMP and CRP-S site in its promoter. Negatively regulated at the post-translational level via degradation by Lon protease. {ECO:0000269|PubMed:25491382}. |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 15690043; 16606699; 24561554; |
| Motif | |
| Gene Encoded By | |
| Mass | 24,147 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |