| IED ID | IndEnz0002012874 |
| Enzyme Type ID | protease012874 |
| Protein Name |
Endoribonuclease SymE EC 3.1.-.- |
| Gene Name | symE SF4363 S4634 |
| Organism | Shigella flexneri |
| Taxonomic Lineage | cellular organisms Bacteria Proteobacteria Gammaproteobacteria Enterobacterales Enterobacteriaceae Shigella Shigella flexneri |
| Enzyme Sequence | MTDTHSIAQPLEAEVSPANNRQLTVSYASRYPDYSRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPAAAEESELMQSLRKVCKLSARKQRQVQEFIGVITGKQKVA |
| Enzyme Length | 113 |
| Uniprot Accession Number | Q83II5 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.1.-.- |
| Enzyme Function | FUNCTION: Involved in the degradation and recycling of damaged RNA. It is itself a target for degradation by the ATP-dependent protease Lon. {ECO:0000255|HAMAP-Rule:MF_01193}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Domain (1) |
| Keywords | Cytoplasm;DNA-binding;Endonuclease;Hydrolase;Nuclease;RNA-binding;Reference proteome |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000255|HAMAP-Rule:MF_01193}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 12,294 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |