| IED ID | IndEnz0002012943 |
| Enzyme Type ID | protease012943 |
| Protein Name |
Serine protease 29 EC 3.4.21.- Implantation serine proteinase 2 ISP-2 Strypsin-2 Strypsin-related protein Tryptase-like proteinase |
| Gene Name | Prss29 Isp2 |
| Organism | Mus musculus (Mouse) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Glires (Rodents and rabbits) Rodentia Myomorpha (mice and others) Muroidea Muridae Murinae Mus Mus Mus musculus (Mouse) |
| Enzyme Sequence | MLIQLCLTLFFLGCSIAGTPAPGPEDVLMGIVGGHSAPQGKWPWQVSLRIYRYYWAFWVHNCGGSIIHPQWVLTAAHCIRERDADPSVFRIRVGEAYLYGGKELLSVSRVIIHPDFVHAGLGSDVALLQLAVSVQSFPNVKPVKLPSESLEVTKKDVCWVTGWGAVSTHRSLPPPYRLQQVQVKIIDNSLCEEMYHNATRHRNRGQKLILKDMLCAGNQGQDSCYGDSGGPLVCNVTGSWTLVGVVSWGYGCALRDFPGVYARVQSFLPWITQQMQRFS |
| Enzyme Length | 279 |
| Uniprot Accession Number | Q99MS4 |
| Absorption | |
| Active Site | ACT_SITE 77; /note=Charge relay system; /evidence=ECO:0000250; ACT_SITE 124; /note=Charge relay system; /evidence=ECO:0000250; ACT_SITE 228; /note=Charge relay system; /evidence=ECO:0000250 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.21.- |
| Enzyme Function | FUNCTION: Involved in embryo hatching and implantation. {ECO:0000269|PubMed:11467974, ECO:0000269|PubMed:15304212, ECO:0000269|PubMed:17156484}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (3); Chain (1); Disulfide bond (4); Domain (1); Glycosylation (2); Sequence conflict (3); Signal peptide (1) |
| Keywords | Disulfide bond;Glycoprotein;Hydrolase;Protease;Reference proteome;Secreted;Serine protease;Signal |
| Interact With | |
| Induction | INDUCTION: Up-regulated in uterine endometrial glands following the initiation of embryo implantation. By progesterone. {ECO:0000269|PubMed:11467974, ECO:0000269|PubMed:15304212, ECO:0000269|PubMed:15349836}. |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:12112596, ECO:0000269|PubMed:15349836}. Note=Secretion into the glandular and uterine lumen may occur as a consequence of progesterone-induced epithelial differentiation. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..17; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 14583634; 16257142; 21267068; 28049832; 33973295; |
| Motif | |
| Gene Encoded By | |
| Mass | 30,986 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |