| IED ID | IndEnz0002012954 |
| Enzyme Type ID | protease012954 |
| Protein Name |
Probable Ufm1-specific protease 1 UfSP1 EC 3.4.22.- |
| Gene Name | UFSP1 CG30157 |
| Organism | Drosophila melanogaster (Fruit fly) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Ecdysozoa Panarthropoda Arthropoda Mandibulata Pancrustacea Hexapoda Insecta Dicondylia Pterygota (winged insects) Neoptera Endopterygota Diptera Brachycera Muscomorpha Eremoneura Cyclorrhapha Schizophora Acalyptratae Ephydroidea Drosophilidae (pomace flies) Drosophilinae Drosophilini Drosophila (fruit flies) Sophophora melanogaster group melanogaster subgroup Drosophila melanogaster (Fruit fly) |
| Enzyme Sequence | MAAEKCAEEFGDSSAASLKIVPKDYAYPLLEDPQGALTTPTEGGRTLVTRGGFNYFHYGCDGHQDAGWGCGYRTLQSAISWIQRRQGSSGHVPSIREIQQILVAIGDKGPEFVGSRDWIGTLEEFYVIDVLHQVPCKILHAKELSSDEILGELRSYFEKYQGFVAMGGLSDTASKAITGYHCSARGRIFLQVVDPHFVGVPSSRQHLIDLGYVRWVPVDEFAGSTYNLCLILQP |
| Enzyme Length | 234 |
| Uniprot Accession Number | Q4V6M7 |
| Absorption | |
| Active Site | ACT_SITE 70; /evidence=ECO:0000250; ACT_SITE 194; /evidence=ECO:0000250; ACT_SITE 196; /evidence=ECO:0000250 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.22.- |
| Enzyme Function | FUNCTION: Thiol protease which recognizes and hydrolyzes the peptide bond at the C-terminal Gly of UFM1, a ubiquitin-like modifier protein bound to a number of target proteins. {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (3); Chain (1) |
| Keywords | Hydrolase;Protease;Reference proteome;Thiol protease;Ubl conjugation pathway |
| Interact With | A8DYH2 |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 16129837; 22432011; 23071443; 25687947; 31722958; |
| Motif | |
| Gene Encoded By | |
| Mass | 25,791 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |