| IED ID | IndEnz0002013029 |
| Enzyme Type ID | protease013029 |
| Protein Name |
KappaPI-actitoxin-Ael3a KappaPI-AITX-Ael3a Kunitz-type serine protease inhibitor APEKTx1 |
| Gene Name | |
| Organism | Anthopleura elegantissima (Green aggregating anemone) (Actinia elegantissima) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Cnidaria Anthozoa (anthozoans) Hexacorallia Actiniaria (sea anemones) Actiniidae Anthopleura Anthopleura elegantissima (Green aggregating anemone) (Actinia elegantissima) |
| Enzyme Sequence | INSICLLPKKQGFCRARFPRFYYNSSTRRCEMFYYGGCGGNANNFNTLEECEKVCLGYGEAWKAP |
| Enzyme Length | 65 |
| Uniprot Accession Number | P86862 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Dual-function toxin that inhibits both serine proteases (trypsin Kd=124 nM) and voltage-gated potassium channels rKv1.1/KCNA1 (IC(50)=0.9 nM). The activity on the Kv1.1/KCNA1 is selective and reversible. The toxin presumably acts by blocking the channel pore in the open state. {ECO:0000269|PubMed:21477583}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (3); Domain (1); Site (1) |
| Keywords | Direct protein sequencing;Disulfide bond;Ion channel impairing toxin;Nematocyst;Potassium channel impairing toxin;Protease inhibitor;Secreted;Serine protease inhibitor;Toxin;Voltage-gated potassium channel impairing toxin |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000305|PubMed:21477583}. Nematocyst {ECO:0000305}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 7,475 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |