| IED ID | IndEnz0002013056 |
| Enzyme Type ID | protease013056 |
| Protein Name |
Deubiquitinase SseL EC 3.4.22.- Deubiquitinating enzyme DUB Deubiquitinating protease Salmonella secreted effector L |
| Gene Name | sseL STM2287 |
| Organism | Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) |
| Taxonomic Lineage | cellular organisms Bacteria Proteobacteria Gammaproteobacteria Enterobacterales Enterobacteriaceae Salmonella Salmonella enterica (Salmonella choleraesuis) Salmonella enterica I Salmonella typhimurium Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) |
| Enzyme Sequence | MNICVNSLYRLSIPQFHSLYTEEVSDEALTLLFSAVENGDQNCIDLLCNLALRNDDLGHRVEKFLFDLFSGKRTGSSDIDKKINQACLVLHQIANNDITKDNTEWKKLHAPSRLLYMAGSATTDLSKKIGIAHKIMGDQFAQTDQEQVGVENLWCGARMLSSDELAAATQGLVQESPLLSVNYPIGLIHPTTKENILSTQLLEKIAQSGLSHNEVFLVNTGDHWLLCLFYKLAEKIKCLIFNTYYDLNENTKQEIIEAAKIAGISESDEVNFIEMNLQNNVPNGCGLFCYHTIQLLSNAGQNDPATTLREFAENFLTLSVEEQALFNTQTRRQIYEYSLQ |
| Enzyme Length | 340 |
| Uniprot Accession Number | Q8ZNG2 |
| Absorption | |
| Active Site | ACT_SITE 223; /evidence=ECO:0000250; ACT_SITE 285; /note=Nucleophile; /evidence=ECO:0000305 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.22.- |
| Enzyme Function | FUNCTION: Effector proteins function to alter host cell physiology and promote bacterial survival in host tissues. This protease targets the host cell ubiquitin pathway by acting as a deubiquitinase in infected host cells. Specifically hydrolyzes mono- and polyubiquitin substrates in vitro with a preference for 'Lys-63'-linked ubiquitin chains, suggesting that it interferes with a signaling pathway rather than inhibiting proteasomal-dependent degradation of its targets. Does not possess desumoylating activity. Is required for the Salmonella-induced delayed cytotoxicity in macrophages and full virulence. Is not required for intracellular bacterial replication. {ECO:0000269|PubMed:17158898, ECO:0000269|PubMed:17360673}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (2); Beta strand (6); Chain (1); Erroneous initiation (1); Helix (16); Mutagenesis (1); Turn (3) |
| Keywords | 3D-structure;Host cytoplasm;Hydrolase;Protease;Reference proteome;Secreted;Thiol protease;Virulence |
| Interact With | P22059 |
| Induction | INDUCTION: Expression of the gene is induced inside phagocytic cells and is dependent on the SsrA/SsrB system. {ECO:0000269|PubMed:17158898, ECO:0000269|PubMed:17360673}. |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. Host cytoplasm. Note=Secreted via type III secretion system 2 (SPI-2 TTSS), and delivered into the host cytoplasm. In phagocytic cells localizes to the Salmonella-containing vacuole (SCV). In epithelial cells localizes to the Salmonella-containing vacuole (SCV) and to the Salmonella-induced filaments (Sifs), which are tubular membrane extensions from the SCV that are formed at late stages of infection. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | X-ray crystallography (2) |
| Cross Reference PDB | 5HAF; 5UBW; |
| Mapped Pubmed ID | 18354230; 21988961; 27425412; |
| Motif | |
| Gene Encoded By | |
| Mass | 38,221 |
| Kinetics | BIOPHYSICOCHEMICAL PROPERTIES: Kinetic parameters: KM=1.5 uM for ubiquitin-1-amido methyl coumarin (Ub-AMC) {ECO:0000269|PubMed:17360673}; Note=The Vmax of the reaction with ubiquitin-1-amido methyl coumarin (Ub-AMC) as substrate is 2354 pM/sec/uM enzyme.; |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |