| IED ID | IndEnz0002013092 |
| Enzyme Type ID | protease013092 |
| Protein Name |
Zinc finger and BTB domain-containing protein 46 BTB-ZF protein expressed in effector lymphocytes BZEL BTB/POZ domain-containing protein 4 |
| Gene Name | Zbtb46 Btbd4 |
| Organism | Mus musculus (Mouse) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Glires (Rodents and rabbits) Rodentia Myomorpha (mice and others) Muroidea Muridae Murinae Mus Mus Mus musculus (Mouse) |
| Enzyme Sequence | MNNRKEDMEITSHYRHLLRELNEQRQHGVLCDACVVVEGKVFKAHKNVLLGSSRYFKTLYCQVQKTSDQATVTHLDIVTAQGFKAIIDFMYSAHLALTSRNVIEVMSAASFLQMTDIVQACHDFIKAALDISIKSDASDELSEFEIGTPASNSTEALISAVMAGRSISPWLARRTSPANSSGDSAIASCHEGGSSYGKEDQEPKADGPDDVSSQSLWPGDVGYGSLRIKEEQISPSHYGGSELPSSKDTAIQNSLSEQGSGDGWQPTGRRKNRKNKETVRHITQQVEEDSQAGSPVPSFLPTSGWPFSSRDSNVDLTVTEASSLDSRGERAELYAHIDEGLLGGETSYLGPPLTPEKEEALHQATAVANLRAALMSKNSLLSLKADVLGDDGSLLFEYLPKGAHSLSLNEFTVIRKKFKCPYCSFSAMHQCILKRHMRSHTGERPYPCEICGKKFTRREHMKRHTLVHSKDKKYVCKVCSRVFMSAASVGIKHGSRRHGVCADCAGRGVGTPLDHGGGGEGSPEALFAGEGPYLEDPDDPRGEAEEELVEDEDEDVAKWKDDVGLAHEDALLGDDKDDEDSPQGPHSPSGEPDKDFAWIS |
| Enzyme Length | 600 |
| Uniprot Accession Number | Q8BID6 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Functions as a transcriptional repressor for PRDM1. {ECO:0000269|PubMed:22370726}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Alternative sequence (2); Chain (1); Compositional bias (4); Cross-link (1); Domain (1); Erroneous initiation (2); Modified residue (1); Region (3); Sequence conflict (1); Zinc finger (2) |
| Keywords | Alternative splicing;Isopeptide bond;Metal-binding;Nucleus;Phosphoprotein;Reference proteome;Repeat;Transcription;Transcription regulation;Ubl conjugation;Zinc;Zinc-finger |
| Interact With | Q9CQT7 |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Nucleus {ECO:0000305}. |
| Modified Residue | MOD_RES 234; /note=Phosphoserine; /evidence=ECO:0000250|UniProtKB:Q86UZ6 |
| Post Translational Modification | PTM: Sumoylated. Desumoylation by DESI1 reverses transcriptional repression activity. {ECO:0000269|PubMed:22370726}. |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 11217851; 12466851; 12477932; 15618518; 20059953; 20412781; 22615127; 22615130; 22851594; 23219392; 23741395; 23913046; 24043764; 24194600; 24288007; 24439267; 24509714; 25446897; 25902483; 25992862; 26054719; 26453377; 26642357; 26777404; 26982733; 27001748; 27073171; 27147029; 27166946; 27264183; 27626380; 27793594; 27810926; 28002729; 28060909; 28257233; 28550204; 28608405; 28645528; 28666115; 28801233; 29056343; 29166591; 29217759; 29316433; 29321275; 29514067; 29572360; 29593283; 29884909; 29925996; 29997124; 30226829; 30279176; 30552023; 30926233; 31000683; 31039135; 31048369; 31097342; 31185213; 31270275; 31406377; 31406378; 31434685; 31553907; 31848486; 32273468; 32341058; 32624353; 32795402; 32895539; 33257678; 33257753; 34003499; 34108686; 34157302; 34343496; 34351428; 34413303; |
| Motif | |
| Gene Encoded By | |
| Mass | 65,499 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |