| IED ID | IndEnz0002013093 |
| Enzyme Type ID | protease013093 |
| Protein Name |
Putative sortase YwpE EC 3.4.22.- |
| Gene Name | ywpE BSU36340 |
| Organism | Bacillus subtilis (strain 168) |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Firmicutes Bacilli Bacillales Bacillaceae Bacillus Bacillus subtilis group Bacillus subtilis Bacillus subtilis subsp. subtilis Bacillus subtilis (strain 168) |
| Enzyme Sequence | MRRDQKMGEGNYPLAGHHLKQKNLLFGPLENIKTGAQIVITDFKKDYIYSVTSKDIISEMDADVVEETNKKEITLITCDKAVKTEGRLVVKGELVDSFGHTN |
| Enzyme Length | 102 |
| Uniprot Accession Number | P94587 |
| Absorption | |
| Active Site | ACT_SITE 17; /note=Proton donor/acceptor; /evidence=ECO:0000250|UniProtKB:Q2FV99; ACT_SITE 78; /note=Acyl-thioester intermediate; /evidence=ECO:0000250|UniProtKB:Q2FV99 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.22.- |
| Enzyme Function | FUNCTION: Seems not to play a major role if any as a sortase. {ECO:0000305|PubMed:21906378}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (2); Chain (1); Site (1) |
| Keywords | Hydrolase;Protease;Reference proteome;Thiol protease |
| Interact With | |
| Induction | INDUCTION: Preferentially expressed in the late stationary phase. {ECO:0000269|PubMed:21906378}. |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 11,468 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |