| IED ID |
IndEnz0002013111 |
| Enzyme Type ID |
protease013111 |
| Protein Name |
High-affinity zinc uptake system binding-protein ZnuA
|
| Gene Name |
znuA adcA ycdH BSU02850 |
| Organism |
Bacillus subtilis (strain 168) |
| Taxonomic Lineage |
cellular organisms
Bacteria
Terrabacteria group
Firmicutes
Bacilli
Bacillales
Bacillaceae
Bacillus
Bacillus subtilis group
Bacillus subtilis
Bacillus subtilis subsp. subtilis
Bacillus subtilis (strain 168)
|
| Enzyme Sequence |
MFKKWSGLFVIAACFLLVAACGNSSTKGSADSKGDKLHVVTTFYPMYEFTKQIVKDKGDVDLLIPSSVEPHDWEPTPKDIANIQDADLFVYNSEYMETWVPSAEKSMGQGHAVFVNASKGIDLMEGSEEEHEEHDHGEHEHSHAMDPHVWLSPVLAQKEVKNITAQIVKQDPDNKEYYEKNSKEYIAKLQDLDKLYRTTAKKAEKKEFITQHTAFGYLAKEYGLKQVPIAGLSPDQEPSAASLAKLKTYAKEHNVKVIYFEEIASSKVADTLASEIGAKTEVLNTLEGLSKEEQDKGLGYIDIMKQNLDALKDSLLVKS |
| Enzyme Length |
319 |
| Uniprot Accession Number |
O34966 |
| Absorption |
|
| Active Site |
|
| Activity Regulation |
|
| Binding Site |
|
| Calcium Binding |
|
| catalytic Activity |
|
| DNA Binding |
|
| EC Number |
|
| Enzyme Function |
FUNCTION: Part of the high-affinity ABC transporter complex ZnuABC involved in zinc import (Probable). ZnuABC-mediated zinc transport is required for comF expression and competence development. {ECO:0000269|PubMed:21813502, ECO:0000269|PubMed:9811636, ECO:0000305}. |
| Temperature Dependency |
|
| PH Dependency |
|
| Pathway |
|
| nucleotide Binding |
|
| Features |
Beta strand (10); Chain (1); Helix (13); Lipidation (2); Signal peptide (1); Turn (3) |
| Keywords |
3D-structure;Cell membrane;Ion transport;Lipoprotein;Membrane;Palmitate;Reference proteome;Signal;Transport;Zinc;Zinc transport |
| Interact With |
|
| Induction |
INDUCTION: Repressed by zinc via the metallo-regulatory protein Zur. {ECO:0000269|PubMed:12426338, ECO:0000269|PubMed:9811636}. |
| Subcellular Location |
SUBCELLULAR LOCATION: Cell membrane {ECO:0000269|PubMed:22882210, ECO:0000305|PubMed:14730579}; Lipid-anchor {ECO:0000305|PubMed:14730579}. Membrane raft {ECO:0000269|PubMed:22882210}; Lipid-anchor {ECO:0000305|PubMed:14730579}. Note=Present in detergent-resistant membrane (DRM) fractions that may be equivalent to eukaryotic membrane rafts; these rafts include proteins involved in signaling, molecule trafficking and protein secretion. {ECO:0000269|PubMed:22882210}. |
| Modified Residue |
|
| Post Translational Modification |
|
| Signal Peptide |
SIGNAL 1..20; /evidence=ECO:0000255|PROSITE-ProRule:PRU00303 |
| Structure 3D |
X-ray crystallography (1) |
| Cross Reference PDB |
2O1E;
|
| Mapped Pubmed ID |
- |
| Motif |
|
| Gene Encoded By |
|
| Mass |
35,660 |
| Kinetics |
|
| Metal Binding |
|
| Rhea ID |
|
| Cross Reference Brenda |
|